Abstract: The present invention relates to antibodies and antibody fragments thereof that bind to and activate an erythropoietin receptor. The present invention also relates to methods of modulating the endogenous activity of an erythropoietin receptor in a mammal using said antibodies as well as pharmaceutical compositions containing said antibodies.
1. An antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mammal wherein said antibody or antibody fragment is Abl2 (ATCC Accession No. PTA-5554).
2. The antibody or antibody fragment as claimed in claim 1 wherein said antibody or antibody fragment is a monoclonal antibody.
3. The antibody or antibody fragment as claimed in claim 2 wherein said antibody or antibody fragment is selected from the group consisting of Ab3, Abl2, Ab22, Ab54, Ab60, Abl02, Abl35, Abl45, Abl98, Ab254, Ab267, Ab390, Ab412, Ab430/432, Ab467 and Ab484.
4. A pharmaceutical composition comprising a therapeutically effective amount such as herein described of the antibody or antibody fragment as claimed in claims 1-3 and a pharmaceutically acceptable excipient.
ERYTHROPOIETIN RECEPTOR BINDING ANTIBODIES
Application History
This application claims priority to U.S. Provisional Application Serial No. 60/418,031, filed October 14,2002, hereby incorporated by reference in its entirety.
Technical Field of the Invention
The present invention relates to antibodies that recognize, bind to and, preferably, activate the erythropoietin receptor.
Background of the Invention
Erythropoietin ("EPO") is a glycoprotein that is the primary regulator of erythropoiesis. Specifically, EPO is responsible for promoting the growth, differentiation and survival of erythroid progenitors, which give rise to mature red blood cells. In response to changes in the level of oxygen in the blood and tissues, erythropoietin appears to stimulate both proliferation and differentiation of immature erythroblasts. I* also functions as a growth factor, stimulating the mitotic activity of erythroid progenitor cells, such as erythrocyte burst forming and colony-forming units. It also acts as a differentiation factor, triggering transformation of an erythrocyte colony-forming-unit into aproerythroblast (See Erslev, A., NewEng. J. MecL, 316:101-103 (1987)).
EPO has a molecular weight of about 34,000 daltons and can occur in three forms -alpha, beta and asialo. During mid- to late gestation, EPO is synthesized in the fetal liver. Subsequently, EPO is synthesized in the kidney, circulates in the plasma and is excreted in the urine.
Human urinary EPO has been isolated and purified (See, Miyake et al., J. Biol Ghent, 252:5558 (1977)). Moreover, methods for identifying, cloning and expressing genes encoding EPO (See U.S. Patent 4,703,008) as well as purifying recombinant EPO from a cell medium (See U.S. Patent 4,667,016) are known m the art.
The activity of EPO is mediated through the binding and activation of a cell surface receptor referred to as the erythropoietin receptor. The EPO receptor belongs to the cytokine rceptor superfamily and is believed to contain at least two distinct polypeptides, a 55-72 kDa species and a 85-100 kDa species (See U.S. Patent 6,319,499, Mayeux et al., J. BioL Chem, 266:23380 (1991), McCaffery et al., J. BioL Chem., 264:10507 (1991)). Other studies have revealed other polypeptide complexes of EPO receptor having molecular weights such as 110, 130 and 145 kDa (See U.S. Patent 6,319,499).
Both the murine and human EPO receptors have been cloned and expressed (See D'Andrea et al., Cell, 57:277 (1989); Jones et al., Blood, 76:31 (1990); Winkelmann et al., Blood, 76:24 (1990); WO 90/088227 U.S. Patent 5,278,065). The full length human EPO receptor is a 483 amino acid transmembrane protein with an approximately 25 amino acid signal peptide (See U.S. Patent 6,319,499). The human receptor demonstrates about a 82% amino acid sequence homology with the murine receptor. Id.
In the absence of ligand the EPO receptor exists in a preformed dimer. The binding of EPO to its receptor causes a confonnational change such that the cytoplasmic domains are placed in close proximity. While not completely understood, it is believed that mis "dimenzation" plays a role in the activation of the receptor. The activation of the EPO receptc results in a number of biological effects. Some of these activities include stimulation of ' proliferation, stimulation of differentiation and inhibition of apoptosis (See U.S. Patent 6,319,499, Liboi et al., PNAS USA, 90:11351 (1993), Koury, Science, 248:378 (1990)).
It is the relationship between the EPO receptor dimenzation and activation that can be used to identify compounds (i.e. such as antibodies) other than EPO that are capable of: (1) dimerizing the EPO receptor, and (2) activating the receptor. These compounds would be useful in treating mammals suffering from anemia and in identifying mammals haying a dysfunctional EPO receptor.
Summary of the Invention
In one embodiment, the invention relates to antibodies that bind to the human eiythropoietin receptor. In one embodiment, the antibodies comprise a heavy chain variable region that is selected from the group consisting of SEQ ID NOS: 3,7,11,15,19,31,35,39, 43,47,51,55 and fragments thereof. In another embodiment, the antibodies comprise a light chain variable region that is selected from the group consisting of SEQ ID NOS: 5,9,13,17, 21,23,25,27,29,33,37,41,45,49,53, 57 and fragments thereof.
In another embodiment, the present invention relates to an isolated antibody that is capable of binding a human eiythropoietin receptor in a piammal. Such an antibody comprises a heavy chain variable region or a light chain variable region that comprises a continuous sequence from CDRl through CDR3. The amino acid sequence of the heavy chain variable region comprising the continuous sequence from CDRl through CDR3 is selected from the group consisting of: SEQ ED NO:58, SEQ ID NO.59, SEQ ID NO:60, SEQ ID N0:61 and fragments thereof. The amino acid sequence of the light chain variable region comprising the continuous sequence from CDRl through CDR3 is selected from the group consisting of: SEQ ID N0:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID N0:65, SEQ ID NO:66, SEQ ID NO:67, SEQ ID NO:68 and fragments thereof.
In another embodiment, the present invention relates to an antibody that activates an endogenous activity of a human eiythropoietin receptor in a mammal but does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQIDNO:!).
In another embodiment, the present invention relates to an antibody that is capable of activating an endogenous activity of a human eiythropoietin receptor in a mammal, wherein said antibody or antibody fragment thereof exhibits a binding affinity within one hundred fold of the binding affinity of endogenous human erythropoietin to the erythropoietin receptor.
In yet another embodiment, the present invention relates to an antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mammal. The antibody or antibody fragment thereof comprises at least one human heavy chain variable region having the amino acid sequence of SEQ ID NO:3 or antibody fragment thereof, and/or at least one human light chain variable region having the amino acid sequenc
of SEQ ID NO:5 or antibody fragment thereof, provided that said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of RGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID N0:l).
In yet another embodiment, the present invention relates to an antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mamma] The antibody or antibody fragment thereof comprises at least one heavy chain variable region having the amino acid sequence of SEQ ID N0:7 or antibody fragment thereof, and/or at least one light chain variable region having the amino acid sequence of SEQ ID NO:9 or antibody fragment thereof, provided that said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID N0:l).
This embodiment also includes other heavy chain variable regions selected from the group consisting of SEQ ID NO: 11,15,19,31,35,39,43,47,51, and 55 or an antibody fragment of any of these aforementioned SEQ ID NOS, wherein said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of SEQ ID NO:1. Other light chain variable regions included in this embodiment may be selected from the group consisting of SEQ ID NO: 13,17,21,23,25,27,29,33,37,41,45,49, 53 and 57 or an antibody fragment of any of these aforementioned SEQ ID NOS, wherein said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of SEQ ID NO: 1.
In yet another embodiment, the invention provides an antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mammal^ the antibody comprising the amino acid sequences of at least one heavy chain variable region and at least one light chain variable region selected from the group consisting of SEQ ID NO:11/SEQ ID NO:13, SEQ ID NO:15/SEQ ID NO:17, SEQ ID NO:19/SEQ ID NO:21, SEQ ID N0:l 1/SEQ ID NO:23, SEQ ID NO:11/SEQ ID NO:25, SEQ ID NO:11/SEQ ID N0:27, SEQ ID NO: 11/SEQ ID NO:29, SEQ ID NO:31/SEQ ID N0:33, SEQ ID NO:35/SEQ ED NO:37, SEQ ID NO:39/SEQ ID NO:41, SEQ ID NO:43/SEQ ID NO:45, SEQ ED NO:47/SEQ ED NO:49, SEQ ED NO:51/SEQ ID NO:53 and SEQ ED NO:55/SEQ ED NO:57 or antibody
fragment thereof, wherein said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of SEQ ID NO: 1.
In yet another embodiment, the present invention relates to a method of activating an endogenous activity of a human erythropoietin receptor hi a mammal. The method involves the step of administering to a mammal a therapeutically effective amount of an antibody or antibody fragment thereof to activate the EPO receptor. The antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:1).
In yet a further embodiment, the present invention relates to a method of modulating an endogenous activity of a human erythropoietin receptor in a mammal. The method involves administering to a mammal a therapeutically effective amount of an antibody or antibody fragment thereof to modulate the endogenous activity of a human erythropoietin receptor in a mammal but does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO: 1).
In yet a further embodiment, the present invention relates to a method of treating a mammal suffering from pure red cell aplasia induced by neutralizing anti-erythropoietin antibodies. The method involves administering to a mammal m need of treatment a therapeutically effective amount of an antibody or antibody fragment thereof to activate said receptor, wherein said antibody or antibody fragment thereof does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:1).
In yet a further embodiment, the present invention relates to pharmaceutical compositions. The pharmaceutical compositions of the present invention contain a therapeutically effective amount of an antibody or antibody fragment thereof and a phannaceutically acceptable excipienL The antibody or antibody fragment contained in the pharmaceutical composition activates an endogenous activity of a human erythropoietin receptor in a mammal but does not interact with a peptide having an amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:1).
In yet a further embodiment, the present invention relates to an IgG2 antibody or antibody fragment that binds to and activates the erythropoietin receptor. The IgG2 antibodies or antibody fragments of this embodiment bind to and interact with any epitope that is involved in activating the EPO receptor. Such antibodies may be polyclonal or monoclonal antibodies or any antibody fragment thereof. The IgG2 antibodies may be chimeric, humanized or human antibodies.
In yet a further embodiment, the present invention provides a method of activating an endogenous activity of a human eiythropoietin receptor in a mammal comprising the step of administering to a mammal a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to activate the receptor.
In yet a further embodiment, the present invention provides a method of modulating an endogenous activity of a human eiythiopoietin receptor in a maximal comprising the step of administering to a mammal a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to modulate the receptor.
In yet another embodiment; the present invention provides a method of treating a
mammal suffering aplasia, the method Comprising the Step of administering to a mammal in
need of treatment a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to activate the receptor.
In yet another embodiment, the present invention provides a method of treating a mammal suffering aplasia, the method comprising the step of administering to a mammal in need of treatment a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention to modulate the receptor.
In yet another embodiment, the present invention provides a pharmaceutical composition comprising a therapeutically effective amount of an IgG2 antibody or antibody fragment of the invention and a phannaceuticaJly acceptable excipient
Finally, the present invention relates to isolated and purified polynucleotide and am inn acid sequences. The isolated and purified polynucleotide sequences can be selected from the
group consisting of: SEQ ID NO:2, SEQ ID NO:4, SEQ ID NO:6, SEQ ID NO:8, SEQ ID NO:10, SEQ ID NO:12, SEQ ED NO:14, SEQ ED NO:16, SEQ BD NO:18, SEQ ID NO:20, SEQ ID N0:22, SEQ ID NO:24, SEQ ID N0:26, SEQ ID NO:28, SEQ ID NO:30, SEQ ID 010:32, SEQ ID NO:34T SEQ ED N0:36, SEQ ID NO:38, SEQ ID NO:40, SEQ ID NO-.42, SEQ ID NO:44, SEQ ID NO:46, SEQ ID NO:48, SEQ ID NO:50, SEQ ID NO:52, SEQ ED N0:54, SEQ ID NO:56 and fragments, complements and degenerate codon equivalents thereof.
The present invention further relates to isolated and purified amino acid sequences selected from the group consisting of: SEQ ID NO:3, SEQ ED NO:5, SEQ ID N0:7, SEQ ID NO:9, SEQ ID N0:l 1, SEQ ID N0:13, SEQ ID NO:15, SEQ ID NO:17, SEQ ID NO:19, SEQ BD N0:21, SEQ ID NO:23, SEQ ID NO:25, SEQ ID NO:29, SEQ BD NO:31, SEQ ID NO:33, SEQ ID NO:35, SEQ ID NO:37, SEQ ID NO:39, SEQ ID NO:41, SEQ BD NO:43, SEQ ID NO:45, SEQ BD NO:47, SEQ DD NO:49, SEQ ID NO:51, SEQ BD N0:53, SEQ ID NO:55, SEQ ID N0:57, SEQ ID NO:58, SEQ BD N0:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, SEQ ID NO:63, SEQ ID NO:64, SEQ ID NO:65, SEQ ID N0:66, SEQ ID NO:67, SEQ ID NO:68 and fragments and complements and thereof
Brief Description of the Figures
Figure 1 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:69 and SEQ ID NO:70, respectively) and amino acid sequence of the heavy chain of human antibody Abl2. The amino acid sequence comprises SEQ ID NOS:71 through 74. The sequence of the constant region alone is shown as SEQ BD NO:75. The variable chain ends at nucleotide 1283. The variable/constant joining region (underlined) is at nucleotides 1284-1289. The constant region is from nucleotides 1290-2826.
Figure 2 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID N0:76 and SEQ ID N0:77, respectively) and amino acid sequence of the light chain of human antibody Abl2. The amino acid sequence comprises SEQ ID NOS:78. The
sequence of the constant region alone is shown as SEQ ID NO: 79. The variable chain ends at
/ nucleotide!363. The variable/constant joining region (underlined) is at nucleotides 1364-1369.
The constant region is from nucleotides 1370-1618.
Figure 3 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:80 and SEQ ID NQ:81, respectively) and amino acid sequence of the heavy chain of human antibody Abl98. The ammo acid sequence comprises SEQ ID NOS:82 and SEQ ID NOS 72 through 74. The variable chain ends at nucleotide 1304. The variable/constant joining region (underlined) is at nucleotides 1305-1310. The constant region is from nucleotides 1311-2847.
Figure 4 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:83 and SEQ ID NO:84, respectively) and amino acid sequence of the light chain of human antibody Abl98. The amino acid sequence comprises SEQ ID NOS:78. The variable chain ends at nucleotide 1351. The variable/constant joining region (underlined) is at nucleotides 1352-1357. The constant region is from nucleotides 1358-1606.
Figure 5 shows the competition of Abl2 with I25l-labeled EPO for binding to Chinese Hamster Ovary cells expressing recombinant EPO receptor.
Figure 6 shows the results of an EPO dependent human cell proliferation assay using Abl2andAbl98.
Figure 7 shows that Abl2 remains active in inducing the proliferation of F36E cells after storage at 4°C for up to 20 days.
Figure 8 shows that Abl2 induces the formation of CFU-E (colony forming unit-erythroid) from human 36* progenitor cells.
Figure 9 shows the induction of proliferation of human erythroid producing cells with Abl98.
Figure 10 shows that Abl98 induces the formation of CFU-E colonies from cynomologous bone marrow-derived erythroid progenitor cells.
Figure 11 shows that Abl2 does not interact with the peptide SE-3. Ab71 A interacts with the SE-3 peptide.
Figure 12 shows that human Abs secreted by primary hybridomas induce the proliferation of F36E cells.
Figure 13 shows that human Ab supematants secreted by primary hybridomas interact with intact EPO receptor, but not with peptide SE-3.
Figure 14 shows the activity of various concentrations of Abl2 on the proliferation of UT77EPO cells.
Figure 15 shows the activity of various concentrations of Abl98 on the proliferation of UT7/EPO cells.
Figure 16 shows the activity of various concentrations of Abl98 (with or without the addition of a secondary goat anti-human FC antibody) on the growth and proliferation of UT7/EPO cells.
Figure 17 shows the activity of various concentrations of Abl2 (with or without the addition of a secondary goat anti-human FC antibody) on the growth and proliferation of UT7/EPO cells.
Figure 18 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-003 of the invention, with Figure ISA (SEQ ID NO: 10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 18B (SEQ ID NO:11) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure ISA, Figure ISC (SEQ ID NO: 12) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 18D (SEQ ID NO: 13) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 18C.
Figure 19 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by
cell line designated ABT2-SCX-012 (also referred to herein as Abl2) of the invention, with Figure 19A (SEQ ID NO:2) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 19B (SEQ ID NO:3) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 19A, Figure 19C (SEQ ID NO:4) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 19D (SEQ ID NO:5) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 19C.
Figure 20 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-022 of the invention, with Figure 20A (SEQ ID NO.14) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 20B (SEQ ID NO:15) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 20A, Figure 20C (SEQ ID NO: 16) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 20D (SEQ ID NO:17) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 20C.
Figure 21 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABI2-SCX-054 of the invention, with Figure 21A (SEQ ID NO: 18) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 21B (SEQ ID NO: 19) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 21 A, Figure 21C (SEQ ID NO:20) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 21D (SEQ ID NO:21) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 21C.
Figure 22 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-060 of the invention, with Figure 22A (SEQ ID NO: 10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 22B (SEQ ID NO: 11) representing the amino acid sequence encoded by the nucleotide
seqiignce shown in Figure 22A, Figure 22C (SEQ ID NO:22) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 22D (SEQ ED NO:23) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 22C.
Figure 23 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-102 of the invention, with Figure 23A (SEQ ED NO:10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 23B (SEQ ID N0:l 1) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 23A, Figure 23C (SEQ ID NO:24) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 23D (SEQ ID NO:25) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 23C.
Figure 24 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-135 of the invention, with Figure 24A (SEQ ID NO:10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 24B (SEQ ID NO:11) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 24A, Figure 24C (SEQ ID NO:26) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 24D (SEQ ID NO:27) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 24C.
Figure 25 is a series of representations of the heavy chain and Light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-145 of the invention, with Figure 25A (SEQ ID NO:10) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 25B (SEQ ID NO:11) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 25A, Figure 25C (SEQ ID NO:28) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 25D (SEQ ID NO:29)
representing the amino acid sequence encoded by the micleotide sequence shown in Figure
Figure 26 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-198 (also referred to herein as Abl98) of the invention, with Figure 26A (SEQ ID NO.6) representing the nucleotide sequence encoding me variable region of the heavy chain, Figure 26B (SEQ ID NO:7) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 26A, Figure 26C (SEQ ID NO:8) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 26D (SEQ ID NO:9) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 26C.
Figure 27 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-254 of the invention, with Figure 27A (SEQ ID NO:30) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 27B (SEQ ID NO:3 1) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 27A, Figure 27C (SEQ ED NO:32) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 27D (SEQ ID NO:33) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 27C.
Figure 28 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-267 of the invention, with Figure 28A (SEQ ID NO-.34) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 28B (SEQ ID NO:35) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 28A, Figure 28C (SEQ ID NO:36) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 28D (SEQ ID NO:37) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 28C.
Figure 29 is a table showing amino acid sequence alignments of heavy chain variable regions of anti-EPOr mAbs generated according to the invention with their associated gennline variable region sequences and identifying framework regions and complementarity letermining regions.
Figure 30 is a table showing amino acid sequence alignments of light chain variable regions of anti-EPOr mAbs generated according to the invention with their associated gennline variable region sequences and identifying framework regions and complementarity determining regions.
Figure 31 is a graph comparing the erythropoietic activity, at various concentrations, of a gamma-1 Ab 12 monoclonal antibody (Mab) and a gamma-2 Ab 12 Mab on an F36e human erythroleukemic cell line.
Figure 32 is a graph showing the increase in percent reticulocyte and percent hematocrit in trangenic mice subjected to a multiple dosing regimen of vehicle, Epogen (5U) or Ab 12 antibody (5 or 50 ug).
s.
Figure 33 is a graph showing the increase in percent hematocrit in transgenic mice subjected to a weekly dosing regimen (over 3 weeks) of various concentrations of Aranesp™ or Ab 12.
Figure 34 is a graph showing the increase in percent hematocrit in transgenic mice subjected to single versus weekly dosing regimens of various concentrations of Aranesp™ or Abl2.
Figure 35 is a series of representations of the heavy chain and tight chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell tine designated ABT2-SCX-390 of the invention, with Figure 35A (SEQ ID N0:38) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 35B (SEQ ID N0:39) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 35 A, Figure 35C (SEQ ID NO:40) representing the nucleotide sequence encoding the variable region of the tight chain, and Figure 35D (SEQ ID NO:41)
representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 35C.
Figure 36 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-412 of the invention, with Figure 36A (SEQ ID N0:42) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 36B (SEQ ID NO:43) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 36A, Figure 36C (SEQ ID NO:44) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 36D (SEQ ED NO:45) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 36C.
Figure 37 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-430/432 of the invention, with Figure 37A (SEQ ED NO:46) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 37B (SEQ ID NO:47) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 37A, Figure 37C (SEQ ID NO:48) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 37D (SEQ ID NO:49) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 37C.
Figure 38 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-467 of the invention, with Figure 38A (SEQ ID NO:50) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 38B (SEQ ID NO:51) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 38A, Figure 38C (SEQ ID NO:52) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 38D (SEQ ID NO:53) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 38C.
Figure 39 is a series of representations of the heavy chain and light chain variable region nucleotide and amino acid sequences of the human anti-EPO-R antibody expressed by the cell line designated ABT2-SCX-484 of the invention, with Figure 39A (SEQ ID NO:54) representing the nucleotide sequence encoding the variable region of the heavy chain, Figure 39B (SEQ ID NO:55) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 39A, Figure 39C (SEQ ED NO:56) representing the nucleotide sequence encoding the variable region of the light chain, and Figure 39D (SEQ ID NO:S7) representing the amino acid sequence encoded by the nucleotide sequence shown in Figure 39C.
Figure 40 is a table showing amino acid sequence alignments of heavy chain variable regions of anti-EPOr mAbs generated according to the invention with their associated germline variable region sequences and identifying framework regions and complementarity determining regions.
Figure 41 is a table showing amino acid sequence alignments of light nfrain variable regions of anti-EPOr mAbs generated according to the invention with their associated germline variable region sequences and identifying framework regions and complementarity determining regions.
Figure 42 shows the isolated and purified polynucleotide (top strand and bottom stands, SEQ ID NO.86 and SEQ ID NO:87, respectively) and amino acid sequence of the heavy chain of human antibody Ab390. The amino acid sequence comprises SEQ ID NOS:88 and SEQ ID NOS 72 through 74. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 46*4-469. The constant region is from nucleotides 470-2006.
Figure 43 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:89 and SEQ ID NO:90, respectively) and amino acid sequence of the light chain of human antibody Ab390. The amino acid sequence comprises SEQ ID NOS:91. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 464-469. The constant region is from nucleotides 470-718.
Figure 44 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:92 and SEQ ID N0:93, respectively) and amino acid sequence of the heavy chain of human antibody AM12. The amino acid sequence comprises SEQ ID NOS:94 and SEQ ID NOS 72 through 74. The variable chain ends at nucleotide 469. The variable/constant joining region (underlined) is at nucleotides 470-475. The constant region is from nucleotides 476-2012.
Figure 45 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:95 and SEQ ID NO:96, respectively) and amino acid sequence of the light chain of human antibody AM12. The amino acid sequence comprises SEQ ID NOS:97. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 464-469. The constant region is from nucleotides 470-718.
Figure 46 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ED NO:98 and SEQ ID NO:99, respectively) and amino acid sequence of the heavy chain of human antibody Ab432. The amino acid sequence comprises SEQ ID NOS: 100 and SEQ ID NOS 72 through 74. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 464-469. The constant region is from nucleotides 470-2006.
Figure 47 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:101 and SEQ ID NO:102, respectively) and amino acid sequence of the light chain of human antibody Ab430. The amino acid sequence comprises SEQ ED NOS:103. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 464-469. The constant region is from nucleotides 470-718.
Figure 48 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:104 and SEQ ID NO:105, respectively) and amino acid sequence of the heavy chain of human antibody Ab467. The amino acid sequence comprises SEQ ID NOS:106 and SEQ ID NOS 72 through 74. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 464-469. The constant region is from nucleotides 470-2006.
Figure 49 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:107 and SEQ ID NO:108, respectively) and amino acid sequence of the light chain of human antibody Ab467. The amino acid sequence comprises SEQ ID NOS:109. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 464-469. The constant region is from nucleotides 470-718.
Figure 50 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO:110 and SEQ ID N0:l 11, respectively) and amino acid sequence of the heavy chain of human antibody AM84. The amino acid sequence comprises SEQ ID NOS:112 and SEQ EDNOS 72 through 74. The variable chain ends at nucleotide 469. The variable/constant joining region (underlined) is at nucleotides 470-475. The constant region is from nucleotides 470-2012.'
Figure 51 shows the isolated and purified polynucleotide (top strand and bottom strands, SEQ ID NO.l 13 and SEQ ID NO:114, respectively) and amino acid sequence of the light chain of human antibody Ab484. The amino acid sequence comprises SEQ JD NOS:115. The variable chain ends at nucleotide 463. The variable/constant joining region (underlined) is at nucleotides 464-469. The constant region is from nucleotides 470-718.
Detailed Description of the Invention Definitions
As used herein, me term "antibody" or "immunoglobulin" refers to single chain, two-chain, and multi-chain proteins and glycoproteins that belong to the classes of polyclonal, monoclonal, chimeric and human or humanized. The term "antibody" also includes synthetic and genetically engineered variants thereof.
As used herein, the term "antibody fragment;" refers to Fab, Fab', F(ab')2 and Fv fragments, as well as any portion of an antibody having specificity toward at least one desired epitope.
As used herein, the term "gamma-2", "gamma-2 isotype" or "IgG2" refers to subclass 2 of immunoglobulin G (IgG), as well as any antibody fragment thereof. The four subclasses of IgG molecules are well characterized and well known to those of ordinary skill in the art (See
for example, Molecular Biology of the Cell, 2nd Edition by Bruce Alberts et oL, 1989) Panels of monoclonal antibodies are available that recognize all human isotypes (IgAJgG, IgD IgE, and IgM) and subisotypes (IgAlJgA2, IgOl, IgG2, IgO3, and IgG4) of human immunoglobuUns.
As used herein, the term "humanized antibody" refers to an antibody that is derived from a non-human antibody (Le murine) mat retains or substantially retains the antigen-binding properties of the parent antibody but is less immunogenic hi humans.
As used herein, the term "human antibody" refers to an antibody that possesses a sequence that is derived from a human germ-line immunoglobulin sequence, such as antibodies derived from transgenic mice having human immunoglobulin genes (e.g., XenoMouse® mice), human phage display libraries, or human B cells.
As used herein, the term "epitope" refers to any protein determinate capable of specifically binding to an antibody or T-cell receptors. Epitopic determinants usually consist of chemically active surface groupings of molecules such as amino acids or sugar side chains and usually have specific three dimensional structural characteristics, as well as specific charge characteristics.
As used herein, the term "endogenous" refers to a product or activity arising in the body or cell as opposed to a product or activity coming from outside.
As used herein the phrase, a polynucleotide "derived from" or "specific for a designated sequence refers to a polynucleotide sequence mat comprises a contiguous sequence of approximately at least 6 nucleotides, preferably at least about 8 nucleotides, more preferably at least about 10-12 nucleotides, and even more preferably at least about 15-20 nucleotides corresponding, i.e., identical or complementary to, a region of the designated nucleotide sequence. The sequence may be complementary or identical to a sequence that is unique to a particular polynucleotide sequence as determined by techniques known in the art Regions from which sequences may be derived, include but are not limited to, regions encoding specific epitopes, as well as non-translated and/or non-transcribed regions.
The derived polynucleotide will not necessarily be derived physically from the oucleotide sequence of interest under study, but may be generated in any manner, including, : not limited to, chemical synthesis, replication, reverse transcription or transcription, that is
1 on the information provided by the sequence of bases in the regjon(s) from which the polynucleotide is derived. As such, it may represent either a sense or an antisense orientation of the original polynucleotide. In addition, combinations of regions corresponding to that of the designated sequence may be modified in ways known in the art to be consistent with the intended use.
As used herein, the phrase "encoded by*1 refers to a nucleic acid sequence that codes for a polypeptide sequence, wherein the polypeptide sequence or a portion thereof contains an amino acid sequence of at least 3 to 5 amino acids, more preferably at least 8 to 10 amino acids, and even more preferably at least 15 to 20 amino acids from, a polypeptide encoded by
i
the nucleic acid sequence. Also encompassed are polypeptide sequences that are immunologicaUy identifiable with a polypeptide encoded by the sequence. Thus, a "polypeptide," "protein" or "amino acid" sequence has at least about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95% or more identity to the antibodies of the present invention. Further, the antibodies of the present invention may have at least about 60%, 70%, 75%, 80%, 85%, 90% or 95% similarity to a polypeptide or amino sequences of the antibodies of the present invention. The amino acid sequences of the antibodies of the present invention can be selected from the group consisting of SEQUENCE ID NOS: 3,5,7,9,11,13,15,17,19,21,23,25, 27,29,31,33,35,37,39,41,43,45,47,49,51,53,55 and 57. Preferred amino acid sequences of the antibodies of the present invention are selected from the group consisting of SEQ ID NOS: 3,5,7,9, 51 and 53.
As used herein, the phrase "recombinant polypeptide," "recombinant protein," or "a polypeptide produced by recombinant techniques", which terms may be used interchangeably herein, describes a polypeptide that by virtue of its origin or manipulation is not associated with all or a portion of the polypeptide with which it is associated in nature and/or is linked to a polypeptide other than that to which it is lined in nature. A recombinant or encoded polypeptide or protein is not necessarily translated from a designated nucleic acid sequence. It also may be generated in any manner, including chemical synthesis or expression of a recombinant expression system.
As used herein, the phrase, "synthetic peptide" refers to a polymeric form of amino acids of any length, which may be chemically synthesized by methods well known in the art (See U.S. Patents 4,816,513,5,854,389,5,891,993 and 6,184,344).
As used herein, the term "polynucleotide" refers to a polymeric form of nucleotides of any length, either ribonucleotides or deoxyribonucleotides. This term refers only to the primary structure of the molecule. Thus, the term includes double and single-stranded DNA as well as double- and single-stranded RNA. It also includes modifications, such as methylan'on or capping and unmodified forms of the polynucleotide. The terms "polynucleotide", "oligomer," "oligonucleotide," and "oligo," are used interchangeably herein.
As used herein the phrase "purified polynucleotide" refers to a polynucleotide of interest or fragmentther^f tfrrt is eysentiafly fh?-, eg- contains less than about 50%L60%, 70%, 75%, 80%, 85%, 90%, 95% of the protein with which the polynucleotide is naturally associated. Techniques for purifying polynucleotides of interest are well known hi the art anc
j- ' j • . m
include, for example, disruption of the cell containing the polynucleotide with a chaotropic agent and separation of the polynucleotide(s) and proteins by ion-exchange chromatography, affinity chromatography and sedimentation according to density.
As used herein, the phrase "purified polypeptide'' or "purifiedprotein" means a ""] polypeptide of interest or fragment thereof which is essentially free of, e.g., contains less than about 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, cellular components with which the polypeptide of interest is naturally associated. Methods for purifying polypeptides of interest are known in the art
As used herein, the term "isolated" refers to material thai is removed jrom its original environment (e.g., the natural environment if it is naturally occurring). For example, a naturally occurring polynucleotide or polypeptide present in a living animal is not isolated, but Ihe same polynucleotide or DNA or polypeptide, separated from some or all of the coexisting materials in the natural system, is isolated. Such polynucleotide could be part of a vector and/or such polynucleotide or polypeptide could be part of a composition, and still be isolated in that the vector or composition is not part of its natural environment
As used herein, the term "polypeptide" and "protein" are used interchangeably and
refer to at least one molecular chain of amino acids linked through covalent and/or non-
covalent bonds. The terms do not refer to a specific length of the product Thus, peptides, oligopeptides and proteins are included within the definition of polypeptide. The terms include post-translational modifications of the polypeptide, including, but not limited to, glycosylations, acetylations, phosphoiylations and the like. In addition, protein fragments, analogs, mutated or variant proteins, fusion proteins and the like are included within the meaning of polypeptide.
As used herein, the phrase "recombinant host cells," "host cells," "cells," "cell lines," "cell cultures," and other such terms denoting microorganisms or higher eukaryotic cell lines cultured as unicellular entities refer to cells that can be, or have been, used as recipients for recombinant vector or other transferred DNA, and include the original progeny of the original cell that has been transfected.
As used herein, the term "replicon" refers to any genetic element, such as a plasmid, a chromosome or a virus, that behaves as an autonomous unit of polynucleotide replication within a cell.
As used herein, the term "operably linked" refers to a situation wherein the components described are in a relationship permitting them to function in their intended manner. Thus, for example, a control sequence "operably linked" to a coding sequence is ligated in such a manner that expression of the coding sequence is achieved under conditions compatible with the control sequence.
As used herein, the term "vector" refers to a replicon in which another polynucleotide segment is attached, such as to bring about the replication and/or expression of the attached segment
As used herein, the term "control sequence" refers to a polynucleotide sequence that is necessary to effect the expression of a coding sequence to which it is ligated. The nature of such control sequences differs depending upon the host organism. In prokaryotes, such control
sequences generally include a promoter, a ribosomal binding site and terminators and, in some instances, enhancers. The term, "control sequence" thus is intended to include at a minimum components whose presence is necessary for expression, and also may include additional
components whose presence is advantageous, for example, leader sequences.
The term "transfection" refers to the introduction of an exogenous polynucleotide into a prokaryotic pr eucaryotic host cell, irrespective of the method used for the introduction. The term "transfection" refers to both stable and transient introduction of me polynucleotide, and encompasses direct uptake of polynucleotides, transformation, transduction and f-mating. Once introduced into the host cell, the exogenous polynucleotide may be maintained as a non-integrated replicon, for example, a plasmid, or alternatively, may be integrated into the host genome.
As used herein, the term "treatment" refers to prophylaxis and/or therapy.
As used herein, me term "purified product" refers to a preparation of the product which has been isolated from the cellular constituents with which the product is normally associated and from other types of cells that may be present in me sample of interest
«
As used herein, the phrase "activation of an erythropoietin (EPO) receptor" refers to one or more molecular processes which an EPO receptor undergoes that result hi the transduction of a signal to the ulterior of a receptor-bearing cell. Ultimately, this signal brings about one or more changes in cellular physiology. Activation of the EPO receptor typically results in the proliferation or differentiation of EPO receptor-bearing cells, such as, but not limited to, erythroid progenitor cells. A number of events are involved in the activation of the EPO receptor, such as, but not limited to, the dimerization of the receptor.
The structural unit of an antibody is a tetramer. Each tetxamer is composed of two identical pairs of polypeptide chains, each pair having one "light" (25 kDa) and one "heavy" chain (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region that is primarily responsible for antigen recognition. The carboxy-terminal portion of the chain defines a constant region that is responsible for the effector function of the antibody. Human light chains are classified as kappa and lambda light chains. Heavy chains are classified as mu,
delta gamma, alpha, or epsilon and define the antibody's isotype as IgM, IgD, IgG, IgA, and IgE. IgG immunoglobulins are classified further into four subclasses (IgGl, IgG2, IgG3 and IgG4) having gamma-1, gamma-2, gamma-3 and gamma-4 heavy chains, respectively. Most of the therapeutic human, chimeric or humanized antibodies available are of the IgGl antibody type including Herceptin for breast cancer, Rituxan for Non-Hodgkins lymphoma and Humira and Remicade foi rheumatoid arthritis (See Glennie, MJ. et aL, Drug Discovery Today, 8:503 (2003).
Within the light and heavy chains, the variable and constant regions are joined by a "J" region with the heavy chain also include a "D" region. The variable regions of each light/heavy chain pah* form the antigen binding site. Thereupon, an intact antibody has two binding sites, which, except in bifunctional or bispecific antibodies, are the same. Bifunctional or bispecific antibodies are artificial hybrid antibodies that have two different heavy/light chain pairs and two different binding sites. Bifunctional or bispecific antibodies can be produced using routine techniques known in the art
The structure of the chains of an antibody exhibit the same general structure of
t
relatively conserved framework regions (FR) joined by three hyper variable regions, also called complementarity determining regions or CDRs. The CDRs from the two chains of each pair are aligned by the framework regions, enabling binding to a specific epitope. From N-terminal to C-tenninal, both the light and heavy chains comprise the domains FR1, CDR1, FR2, CDR2, FR3, CDR3 and FR4.
U.S. Palest 6,319,499 describes antibodies that bind to and activate an erythropoietin receptor (EPO-R). The antibodies specifically identified in this patent are Mabs 71 and 73. Mab 71 binds to a peptide designated "SE-3" having the amino acid sequence of PGNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO:1) (See Example 3). SE-3 is located on the human EPO-R between amino acid residues 49-78. According to U.S. Patent 6,319,499, when this region of the EPO-R (i.e. amino acid residues 49-79) is bound with a cross linker such as Mab 71, this results in the activation of the EPO receptor. Example 6 in U.S. Patent 6,319,499 states that Mab 71 binds "significant amounts of peptide SE-3" compared to other peptides tested. This example further states that this "indicates that Mab 71 binds to a region of the human EPO-R containing or overlapping residues 49 to 78." Mabs 71
a 73 are marine antibodies. Although rodent and human antibodies may both provide precision for target specificity, human antibodies interact far more effectively with the natural defenses of the body and do not elicit anti-antibody responses to the same extent as rodent antibodies (Winter, G. and Mustein, C. Nature 349:293 (1991). Additionally, the flexibility of human IgG subclasses differ (Roux, KJL et al., J. Imimmol. 159:3372 (1997) and this difference also extends to rodent IgG isotypes since rodent IgG isotypes differ from theii human counterparts. Since protein flexibility may affect antibody-antigen recognition (Jimenez, R., et al. Proc. Nad. Acad Sci. USA, 100:92 (2003), human IgG2 isotypes may result in antigen recognition mechanisms distinct from those of murine antibodies. Murine IgG isotypes generally differ fiom those of humans.
In one embodiment, the present invention relates to an antibody or antibody fragment that binds to the erythropoietin receptor. The antibody or antibody fragment that binds to the erythropoietin receptor comprises at least one heavy chain having an amino acid sequence selected from me group consisting of: SEQ ID NOS: 3,7,11,15,19,31,35,39,43,47,51,55 and fragments thereof. In a second embodiment, the antibody or antibody fragment that binds to the erythropoietin receptor comprises at least one light chain having an amino acid sequence selected from the group consisting of: SEQ ID NOS: 5,9,13,17,21,23,25,27,29,33,37,41, 45,49,53,57 and fragments thereof.
In a third embodiment, the present invention relates to an isolated antibody that is capable of binding a human erythropoietin receptor in a mammal. More specifically, the antibody comprises a heavy chain variable region or a light chain variable region which comprises a continuous sequence from CDR1 through CDR3. The amino acid sequence of the heavy chain variable region comprising the continuous sequence from CDR1 through CDR3 is selected from the group consisting of: SEQ ID NO:58, SEQ ID N0:59,, SEQ ID NO:60 and SEQIDNO:61, and fragments thereof. The amino acid sequence of the light chain variable region comprising the continuous sequence from CDR1 through CDR3 is selected from the group consisting of: SEQ ID NO:62, SEQ ID NO:63, SEQ ID N0:64, SEQ ID NO:65, SEQ ID NO:66, SEQ ID NO:67, and SEQ ID NO:68, and fragments thereof. In addition, the present invention relates to an isolated antibody which comprises a heavy chain variable region or a light chain variable region which comprises at least one CDR. More specifically, the antibody comprises a heavy chain variable region comprising at least one CDR selected from
the gryip consisting of amino acid residues 99-112 of SEQ ID NO: 11,26-35 of SEQ ID NO:3, 50-65 of SEQ ID NO:3,98-105 of SEQ ID NO:3,26-35 of SEQ ID NO.19,50-66 of SEQ ID :19,99-105 of SEQ ID NO:19,50-66 of SEQ ID NO:31,99-105 of SEQ ID N0:31,26-35 of SEQ ID N0:39,50-65 of SEQ ID NO:39,98-105 of SEQ ID N0:39,26-37 of SEQ ID N0:43,52-67 of SEQ ID N0:43,100-107 of SEQ ID NO:43,26-35 of SEQ ID N0:47,50-65 of SEQ ID NO:47,26-35 of SEQ ID NO-.51,50-65 of SEQ ID NO:51,98-105 of SEQ ID NO:51,26-37 of SEQ ID NO:55 and 52-67 of SEQ ID NO:55 or a light chain variable region comprising at least one CDR selected from the group consisting of amino acid residues 24-34 of SEQ ID NO:13,50-56 of SEQ ID N0:13,89-97 of SEQ ID NO:5,24-34 of SEQ ID N0:27, 50-56 of SEQ ID NO:9,24-39 of SEQ ID NO:33,55-61 of SEQ ID NO:33,24-34 of SEQ ED N0:41, 89-97 of SEQ ED N0:41,24-34 of SEQ ED NO:45,50-56 of SEQ ID NO:45, 89-97 of SEQ ID NO.-45,89-97 of SEQ ED N0:49 and 24-34 of SEQ ED N0:57.
In a fourth embodiment, the present invention relates to an antibody or antibody fragment that binds to and activates the eiytbropoietin receptor. The antibodies of the present invention bind to at least one epitope that is involved in activating the EPO receptor (Example 4). Unlike other antibodies or fragments known in the art that bind to and activate an erythropoietin receptor, such as the antibodies described in U.S. Patent 6,319,499, the antibodies of the present invention do not interact with the peptide designated SE-3. Surprisingly, the antibodies of the present invention are erythropoietic even though the antibodies do not bind to the SE-3 peptide. Therefore, the human antibodies of the present invention interact -with at least one different epitope on the human EPO receptor than the antibodies described in U.S. Patent 6,319,499.
In a fifth embodiment, the present invention relates to an IgG2 antibody or antibody fragment that binds to and activates the erythropoietin receptor. The IgG2 antibodies or antibody fragments of this embodiment bind to and interact with any epitope that is involved in activating the EPO receptor.
Additionally, as demonstrated by the BIAcore results shown in Example 1, the antibodies of the present invention exhibit a binding affinity to the erythropoietin receptor within one hundred fold of the binding affinity of endogenous human erythropoietin to the erythropoietin receptor. A high (~lnM) and low (~luM) affinity of the EPO receptor for EPO
has been reported resulting from two nonequivalent receptor binding sites on EPO (See Pbilo, J.S.etal., Biochemistry, 35:1681 (1996)).
The antibodies of the present invention can be polyclonal antibodies, monoclonal antibodies, chimeric antibodies (See U.S. Patent 6,020,153) or human or humanized antibodies or antibody fragments thereof. Synthetic and genetically engineered variants (See U.S. Patent 6,331,415) of any of the foregoing are also contemplated by the present invention. Preferably, however, the antibodies of the present invention are human or humanized antibodies. The advantage of human or humanized antibodies is that they potentially decrease or eh'minafe the immunogenicity of the antibody in a host recipient, thereby permitting an increase in the bioavailability and a reduction in the possibility of adverse immune reaction, thus potentially enabling multiple antibody administrations.
Humanized antibodies include chimeric or CDR-grafted antibodies. Also, human
antibodies can be produced using genetically engineered strains of animals in which the
., " .. . i .
antibody gene expression of the animal is suppressed and functionally replaced with human
antibody gene expression.
Methods for making humanized and human antibodies are known in the art. One method for making human antibodies employs the use of transgenic animal st such as a ttansgenic mouse. These transgenic anim,alg contain a substantial portion of the human antibody producing genome inserted into their own genome and the animal's own endogenous antibody production is rendered deficient hi the production of antibodies. Methods for making such transgenic animals are known in the art. Such transgenic animals can be made using XenoMouse® technology or by using a "minilocus" approach. Methods for making Xenomice™ are described in U.S. Patent Nos. 6,162,963, 6,150,584, 6,114,598 and 6,075,181. Methods for making transgenic animals using the "mirnlocus" approach are described in U.S. Patents 5,545,807, 5,545,806 and 5,625,825. Also see International Publication No. W093/12227.
Using the XenoMouse® technology, human antibodies can be obtained by i
a XenoMouse® mouse (Abgernx, Fremont, California) with an antigen of interest The lymphatic cells (such as B-cells) are recovered from the mice that express antibodies. These
recovered cells can be fused with myeloid-type cell line to prepare immortal hybridoma cell lines. These hybridoma cell lines can be screened and selected to identify hybridoma cell lines that produce antibodies specific to the antigen of interest Alternatively, the antibodies can be expressed in cell lines other than hybridoma cell lines. More specifically, sequences encoding particular antibodies can be cloned from cells producing the antibodies and used for
transformation of a Suitable mammalian host Cell.
Transformation can be by any known method for introducing polynucleotides into a host cell, including, for example, packaging the polynucleotide in a virus or into a viral vector and transducing a host cell with a virus or vector or by transfection procedures known in the art such as those described in U.S. Patents 4,399,216, 4,912,040, 4,740,461 and 4,959,455. For example, one or more genes encoding the heavy chain can be expressed in a cell and one or more genes encoding the light chain can be expressed in a second cell. The resulting heavy and light chains can then be fused together to form the antibodies of the present invention using techniques known in the art. Alternatively, genes encoding for parts of the heavy and light chains can be ligated using restriction endonucleases to reconstruct the gene coding for each chain. Such a gene can then be expressed in a cell to produce the antibodies of the present invention.
The transformation procedure used will depend upon the host to be transformed. Methods for introducing heterologous polynucleotides into mammalian cells are well known in the art and include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, elect-operation, encapsulation of the polynucleotide(s) into liposomes and direct microinjection of the DNA molecule.
Mammalian cell lines that can be used as hosts for expression are well known in the art and include, but are not limited to, Chinese hamster ovary (CHO) cells, HeLa cells, baby hamster kidney (BHK) cells, monkey kidney cells (COS), human hepatocellular carcinoma cells bacterial cells, such as E. coli, yeast cells, such as Saccharomyces cerevisiae, etc.
Humanized antibodies can also be made using a CDR-grafted approach. Such humanized antibodies are well known in the art. Generally, humanized antibodies are produced by obtaining nucleic acid sequences that encode the variable heavy and variable light
sequAces of an antibody that binds to the EPO receptor, identifying the complementary determining region or "CDR" in tbe variable heavy and variable light sequences and grafting .
CDR nucleic acid sequences on to human framework nucleic acid sequences. (See, for example, U.S. Patent Nos. 4,816,567 and 5,225,539).
The human framework that is selected is one that is suitable for in vivo administration, meaning that it does not exhibit immunogenicity. For example, such a determination can be made by prior experience with in vivo usage of such antibodies and studies of amino acid similarities.
Methods for cloning nucleic acids are known in the art. These methods involve amplification of the antibody sequences to be cloned using appropriate primers by polymerase chain reaction (PCR). Primers mat are suitable for amplifying antibody nucleic acid sequences and specifically murine variable heavy and variable light sequences are known in the art.
Once the CDRs and FRs of the cloned antibody sequences that are to be humanized are identified, the amino acid sequences encoding the CDRs are identified and the corresponding nucleic acid sequences grafted on to selected human FRs. This can be done using known primers and linkers, the selection of which are known in me art.
After the CDRs are grafted onto selected human FRs, the resulting "humanized" variable heavy and variable light sequences are expressed to produce a humanized Fv or humanized antibody that binds to the EPO receptor. Typically, the humanized variable heavy and light sequences are expressed as a fusion protein with human constant domain sequences so an intact antibody that binds to the EPO receptor is obtained. However, a humanized Fv antibody can be produced that does not contain the constant sequences. Fusion of the human constant sequence to the humanized variable region is preferred.
The EPO receptor that is bound by and preferably activated using the antibodies of the present invention is preferably a mammalian, EPO receptor, most preferably a human EPO receptor. The present invention also contemplates the use of analogs of the EPO receptor, such as those described in U.S. Patent 5,292,654. Human EPO receptor can be purchased from R & D Systems (Minneapolis, Minnesota).
An example of two (2) antibodies that (1) bind to and activate the EPO receptor, (2) do
it interact with a peptide having an amino acid sequence of
GNYSFSYQLEDEPWKLCRLHQAPTARGAV (SEQ ID NO: 1); and (3) exhibit a binding affinity within one hundred fold of the binding affinity of endogeous human EPO to the EPO receptor, are the human antibodies designated Abl2 and Abl98. Abl2 and Abl98 are human antibodies that were developed using the XenoMouse® XenoMax technology described herein (See Example 1).
In another embodiment, the present invention relates to polynucleotide and polypeptide sequences that encode for the antibodies described herein. Preferably, such polynucleotides encode for bom the variable and constant regions of each of the heavy and light chains, although other combinations are also contemplated by the present invention.
The present invention also contemplates oligonucleotide fragments derived from the disclosed polynucleotides and nucleic acid sequences complementary to these polynucleotides. The polynucleotides can be in the form of KNA or DNA. Polynucleotides in the form of DNA, cDNA, genomic DNA, nucleic acid analogs and synthetic DNA are within the scope of the present invention. The DNA may be double-stranded or single-stranded, and if single stranded, may be the coding (sense) strand or non-coding (anti-sense) strand. The coding sequence that encodes the polypeptide may be identical to the coding sequence provided herein or may be a different coding sequence which coding sequence, as a result of the redundancy or degeneracy of the genetic code, encodes the same polypeptide as the DNA provided herein.
Preferably, the polynucleotides encode at least one heavy chain variable region and at least one light chain variable region of the present invention. Examples of such polynucleotides are shown in SEQ ID NOS: 2,4,6,8,10,12,14,16,18,20,22,24,26,28,30, 32,34,36, 38,40,42,44,46,48,50,52,54 and 56 as well as fragments, complements and degenerate codon equivalents thereof. For example, SEQ ID NO: 2 encodes for the heavy chain of Abl2 (variable region) and SEQ ID NO:4 encodes for the light chain of Abl2 (variable region). SEQ ID NO:6 encodes for the heavy chain of Abl98 (variable region) and SEQ ID NO: 8 encodes for the light chain of Abl98 (variable region).
Hie present invention also includes variant polynucleotides containing modifications such as polynucleotide deletions, substitutions or additions, and any polypeptide modification resulting from the variant polynucleotide sequence. A polynucleotide of the present invention • may also have a coding sequence that is a naturally occurring variant of the coding sequence provided herein.
It is contemplated mat polynucleotides will be considered to hybridize to the sequences provided herein if there is at least 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95% identity between the polynucleotide and the sequence.
The present invention further relates to polypeptides that encode for the antibodies of the present invention as well as fragments, analogs and derivatives of such polypeptides. The polypeptides of the present invention may be recombinant polypeptides, naturally purified polypeptides or synthetic polypeptides. The fragment, derivative or analogs of the polypeptides of the present invention may be one in which one or more of the amino acid residues is substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code; or it may be one in which one or more of the amino acid residues includes a substituent group; or it may be on in which the polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol); or it may be one hi which the additional amino acids are fused to the polypeptide, such as a leader or secretory sequence or a sequence that is employed for purification of the polypeptide or a proprotein sequence. Such fragments, derivatives and analogs are within the scope of the present invention.
A polypeptide of the present invention may have an amino acid sequence that is identical to that of the antibodies described herein or that is different by minor variations due to one or more amino acid substitutions. The variation may be a "conservative change" typically in the range of about 1 to 5 amino acids, wherein the substituted amino acid has similar structural or chemical properties, e.g., replacement of leucine with isoleucine or threonine with ;erine. In contrast, variations may include nonconservative changes, e.g., replacement of a ;lycine with a tryptophan. Similar minor variations may also include ammo acid deletions or nsertions or both. Guidance in determining which and how many amino acid residues may be
substituted, inserted, or deleted -without changing biological or immunological activity may be found using computer programs well known in the art, for example DNASTAR software .JPNASTAR, Inc., Madison, Wisconsin).
Preferably, the polypeptides encode at least one heavy chain variable region or at least one light chain variable region of the antibodies of the present invention. More preferably, the polypeptides encode at least one heavy chain variable region and one light chain variable region of the antibodies of the present invention. Examples of such polypeptides are those having the amino acid sequences shown in SEQIDNOS: 3,5,7,9,11,13, IS, 17,19,21,23, 25,27,29,31,33,35,37,39,41,43,45,46,47,49,51,53,55,57,58,59, 60,61, 62, 63, 64, 65,66,67,68, and fragments thereof. Specifically, the heavy chain of Abl2 has the amino acid sequence shown in SEQ ID NO: 3 and the light chain has the amino acid sequence shown in SEQ ID N0:5. The amino acid sequence of the heavy chain of Abl 98 is shown in SEQ ID NO:7 and the light chain has the amino acid sequence shown in SEQ ED NO:9.
The present invention also provides vectors that include the polynucleotides of the present invention, host cells which are genetically engineered with vectors of the present invention and the production of the antibodies of the present invention by recombinant techniques.
Host cells are genetically engineered (transfected, transduced or transformed) with vectors, such as, cloning vectors or expression vectors. The vector may be in the form of a plasmid, a viral particle, a phage, etc. The engineered host cells can be cultured in conventional nutrient media modified as appropriate for activating promoters, selecting transfected cells, etc. The culture conditions, such as temperature, pH and the like, are those previously used with the host cell selected for expression, and will be apparent to those of skilled in the art.
The polynucleotides of the present invention can be employed to produce the polypeptides and hence the antibodies of the present invention. The polynucleotide sequences of the present invention can be included in any one of a variety of expression vehicles, in particular, vectors or plasmids for expressing a polypeptide. Such vectors include chromosomal, nonchromosomal and synthetic DNA sequences, derivatives of SV40, bacterial
plafmids, phage DNA, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, viral DNA such as vaccinia, adenovirus, fowl pox virus and pseudorabies. However, any other plasmid or vector may be used so long as it is replicable and viable in the host
The appropriate DNA sequence may be inserted into the vector by a variety of procedures. In general, the DNA sequence is inserted into appropriate restriction endonuclease sites by procedures known in the art The polynucleotide sequence in the expression vector is operatively linked to an appropriate expression control sequence (i.e. promoter) to direct mRNA synthesis. Examples of such promoters include, but are not limited to, the LTR or the SV40 promoter, the E. coli lac or tip, the phage lambda PL promoter and other promoters known to control expression of genes in prokaryotic or eukaiyotic cells or their viruses. The expression vector also contains a ribosome binding site for translation initiation and a transcription terminator. The vector may also include appropriate sequences for amplifying expression. For example, the vector can contain enhancers, which are transcription-stimulating DNA sequences of viral origin, such as those derived form simian virus such as SV40, polyoma virus, bovine papilloma virus or Moloney sarcoma virus, or genomic, origin. The vector preferably also contains an origin of replication. The vector can be constructed to contain an exogenous origin of replication or, such an origin of replication can be derived from SV40 or another viral source, or by the host cell chromosomal replication mechanism.
In addition, the vectors preferably contain a marker gene for selection of transfected host cells such as dihydrofolate reductase or antibiotics, such as G-418 (geneticin, a neomycin-derivative) or hygromycin, or genes which complement a genetic lesion of the host cells such as the absence of thymidine kmase, hypoxanthine phosphoribosyl transferase, dihydrofolate reductase, etc.
Suitable vectors for use in the present invention are known in the art. Any plasmid or vector can be used in the present invention as long as it is replicable and is viable in the host Examples of vectors that can be used include those that are suitable for mammalian hosts and based on viral replication systems, such as simian virus 40 (SV40), Rous sarcoma virus (RSV), adenovirus 2, bovine papilloma virus (BPV), papovavirus BK mutant (BKV), or mouse and human cytomegalovims (CVM).
In a further embodiment, the present invention relates to host cells containing the above-described constructs. The host cell can be a higher eukaiyotic cell, such as a
cell, or a lower eulcaryotic cell, such as a yeast cell, or the host cell can be a
prokaryotic cell, such as a bacterial cell. Preferably, the host cells provide a suitable environment for the production of active antibodies, since the biosynthesis of functional tetrameric antibody molecules requires correct nascent polypeptide chain folding, glycosylation, and assembly. Example of suitable host cells, include mammalian cells, such as COS-7 cells, Bowes melanoma cells, Chinese hamster ovary (CHO) cells, embryonic lung cells L-132, and mammalian cells of lymphoid origin, such as myeloma or lymphoma cells. The host cells can be transfected with a vector containing a polynucleotide sequence encoding the H-chain alone, with a second vector encoding the light chain alone (such as by using two different vectors as discussed previously). Preferably, the host cells are transfected with two different vectors.
Introduction of the vectors into the host cell can be effected by calcium phosphate transfection, DEAE-Dextran mediated transfection or elect-operation (L. David et al., Basic Methods in Molecular Biology 2nd Edition, Appleton and Lang, Paramount Publishing, East Norwalk, Conn. (1994)).
In order to obtain the antibodies of the present invention, one or more polynucleotide sequences that encode for the light and heavy chain variable regions and light and heavy chain constant regions of the antibodies of the present invention should be incorporated into a vector. Polynucleotide sequences encoding the light and heavy chains of the antibodies of the present invention can be incorporated into one or multiple vectors and then incorporated into the host cells.
Cell lines expressing Abl2 and Ab467 antibodies were deposited with the American! Type Culture Collection (ATCC), 10801 University Boulevard, Manassas, Virginia 201 10, 1 1 under the terms of the Budapest Treaty, on September 30, 2003 and were accorded accession numbers PTA-5554 and PTA-5555. These deposits are provided for the convenience of those skilled in the art and are neither an admission that such deposits are required to practice the invention nor that equivalent embodiments are not within the skill of the art in view of the
present disclosure. The public availability of these deposits is not a grant of a license to make, use or sell the deposited materials under this or any other patents. The nucleic acid sequences of the deposited materials are incorporated in the present disclosure by reference and are controlling if in conflict with any sequence described herein.
The antibodies of the present invention have a number of uses. In general, the antibodies may be used to treat any condition treatable by erytbropoietin or a biologically active variant or analog thereof. For example, antibodies of the invention are useful for treating disorders characterized by low red blood cell levels and/or decreased hemoglobin levels (e.g. anemia). In addition, the antibodies of the invention may be used for treating disorders characterized by decreased or subnormal levels of oxygen in the blood or tissue, such as, for example, hypoxemia or chronic tissue hypoxia and/or diseases characterized by inadequate blood circulation or reduced blood flow. Antibodies of the invention also may be useful in promoting wound healing or for protecting against neural cell and/or tissue damage, resulting from brain/spinal cord injury, stroke and the like. Non-limiting examples of conditions that may be treatable by the antibodies of the invention include anemia, such as chemotherapy-induced anemia, cancer associated anemia, anemia of chronic disease, HTV-associated anemia, bone marrow transplant-associated anemia and the like, heart failure, ischemic heart disease and renal failure. As such, the invention includes methods of treating any of the aforementioned diseases or conditions comprising the step of administering to a mammal a therapeutically effective amount of said antibody. Preferably, the mammal is a human.
The antibodies of the present invention also can be used to identify and diagnose mammals that have a dysfunctional EPO receptor. Mammals that have a dysfunctional EPO receptor are characterized by disorders such as anemia. Preferably, the mammal being identified and diagnosed is a human. Additionally, the antibodies of the present invention can be used in the treatment of anemia in mammals suffering from red blood cell aplasia. Red blood cell aplasia may result from the formation of neutralizing anti-erythropoietin antibodies in patients during treatment with recombinant erythropoietin (Casadevall, N. et al., n. Eng. J. Med. 346: 469 (2002)). The method involves the step of administering to a mammal
suffering from said aplasia and in need of treatment a therapeutically effective amount of the antibodies of the present invention.
In another embodiment of the invention, the EPO receptor antibodies and antibody fragments of the invention also can be used to detect EPO receptor (e.g., in a biological sample, such as tissue specimens, intact cells, or extracts thereof), using a conventional immunoassay, such as an enzyme linked immunosorbent assay (ELIS A), a radioimmunoassay (RIA) or tissue immunohistochemistry. The invention provides a method for detecting EPO receptor in a biological sample comprising contacting a biological sample with an antibody or antibody fragment of the invention and detecting either the antibody (or antibody portion), to thereby detect EPO receptor in the biological sample. The antibody or antibody fragment is directly or indirectly labeled -with a detectable substance to facilitate detection of the bound or unbound antibody or antibody fragment A variety of immunoassay formats may be practiced
(such as competitive assays, direct or indirect sandwich immunoassays and the like) and are
i well known to those of ordinary skill in the art.
Suitable detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkahne phosphatase, B-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine, dansyl chloride or phycoerythrin; and an example of a luminescent material includes luminol; and examples of suitable radioactive material include 1251,1311,35S. or 3H.
In yet another embodiment, the present invention relates to a pharmaceutical composition containing a therapeutically effective amount of the antibody of the present invention along with a phannaceutically acceptable carrier or excipient As used herein, "pharmaceutically acceptable carrier" or "pharmaceutically acceptable excipient" includes any and all solvents, dispersion media, coaling, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like that are physiologically compatible. Examples of phannaceutically acceptable carriers or excipients include one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like as well as combinations
tijtaeof. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition. Phannaceutically acceptable substances such as wetting or minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf hie or effectiveness of the of the antibody or antibody portion also may be included. Optionally, disintegrating agents can be included, such as cross-linked polyvinyl pyrrolidone, agar, alginic acid or a salt thereof such as sodium alginate and the like. In addition to the excipients, the pharmaceutical composition can include one or more of the following, carrier proteins such as serum albumin, buffers, binding agents, sweeteners and other flavoring agents; coloring agents and polyethylene glycol.
The compositions of this invention may be in a variety of forms. They include, for example, liquid, semi-solid and solid dosage forms, such as liquid solutions (e.g. injectable and infusible solutions), dispersions or suspensions, tablets, pills, powders, liposomes and suppositories. The preferred form depends on the intended mode of administration and therapeutic application. Typical preferred compositions are in the form of injectable or infusible solutions, such as compositions similar ID those used for passive immunization of humans with other antibodies. The preferred mode of administration is parenteral (e.g., intravenous, subcutaneous, intraperitoneal, intramuscular). In a preferred embodiment, the antibody is administered by intravenous infusion or injection. In another preferred embodiment, the antibody or antibody fragment is administered by intramuscular or subcutaneous injection.
Other suitable routes of administration for the pharmaceutical composition include, but are not limited to, rectal, transdennal, vaginal, transmucosal or intestinal administration.
Therapeutic compositions typically must be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, dispersion, liposome, or other ordered structure suitable to high drug concentration. Sterile injectable solutions can be prepared by incorporating the active compound (i.e. antibody or antibody fragment) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated
. In the case of sterile powders for the preparation of sterile injectable solutions, the preferred methods of preparation are vacuum drying and freeze-drying that yields a powder of k the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof. The proper fluidity of a solution can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prolonged absorption of injectable compositions can be brought about by including in the composition an agent that delays absorption, for example, monostearate salts and gelatin.
i
The antibodies and antibody fragments of the invention can be administered by a variety of methods known in the art, although for many therapeutic applications, the preferred route/mode of administration is intravenous injection or infusion. As will be appreciated by the skilled artisan, the route and/or mode of administration will vary depending upon the desired results. In certain embodiments, the active compound may be prepared with a carrier that will protect the compound against rapid release, such as a controlled release formulation, including implants, transdermal patches, and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Many methods for the preparation of such formulations are patented or generally known to those skUledin the art. See, e.g. Sustained and Controlled Release Drug Delivery Systems, J. R. Robinson, ed., Marcel Dekker, Inc., New York, 1978).
In certain embodiments, an antibody or antibody portion of the invention may be orally administered, for example, with an inert diluent or an assimilable edible carrier. The compound (and other ingredients if desired) may also be enclosed in a hard or soft shell gelatin capsule, compressed into tablets, buccal tablets, troches, capsules, elixiers, suspensions, syrups, wafers, and the like. To administer an antibody or antibody fragment of the invention by other than parenteral administration, it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivauon.
Supplementary active compounds also can be incorporated into the compositions. In certain embodiments, an antibody or antibody fragment of the invention is coformulated with and/or coadministered with one or more additional therapeutic agents. For example, an EPO
r^Eeptor antibody or antibody fragment of the invention may be coformulated and/or coadministerd with one or more additional antibodies that bind other targets (e.g., antibodies | that bind other cytokines or that bind cell surface molecules) or one or more cytokines. Furthermore, one or more antibodies of the invention may be used in combination, with two or more of the foregoing therapeutic agents. Such combination therapies may advantageously utilize lower dosages of the administered therapeutic agents, thus avoiding possible toxicities or complications associated with the various monotherapies.
As used herein, the term tfherap^utically effective amount" means an amount of antibody or antibody fragment that produces the effects for which it is administered. The exact dose will be ascertainable by one skilled in the art As known in the art, adjustments based on age, body weight, sex, diet, time of administration, drug interaction and severity of condition may be necessary and will be ascertainable with routine experimentation by those skilled in the art. A therapeutically effective amount is also one in which the therapeutically beneficial effects outweigh any toxic or detrimental effects of the antibody or antibody fragment A "prophylactiqally effective amount" refers to an amount effective, at dosages and for periods of time necessary to achieve the desired prophylactic result Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
Dosage regimens may be adjusted to provide the optimum desired response (e.g., a therapeutic or prophylactic response). For example, a single bolus may be administered, several divided doses may be administered over time or the dose may be proportionally reduced or increased as indicated by the exigencies of the therapeutic situation. It is especially advantageous to formulate parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the mammalian subjects to be tested; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on (a) the unique characteristics of the active compound and the particular therapeutic or prophylactic effect to be achieved and (b) the limitations inherent in the art of compounding such an active compound for the treatment of sensitivity hi individuals.
An exemplary, non-limiting range for a therapeutically or prophylactically effective amount of an antibody or antibody portion of the invention is 0.1-20 mg/kg, more preferably 1-W\ 0 mg/kg. It is to be noted that dosage values may vary with the type and severity of the condition to be alleviated. It is to be further understood that for any particular subject, specific dosage regimens should be adjusted over time according to the individual need and the professional judgment of the person administering or supervising the administration of the compositions, and that dosage ranges set forth herein are exemplary only and are not intended to limit the scope or practice of the claimed composition.
By way of example, and not of limitation, examples of the present invention shall now be given.
EXAMPLE 1: Generation of human Erytfaropoietin Receptor antibodies Antigen Preparation. The antigen used for immunization of XenoMouse® animals was coupled to a universal T-cell epitope (TCE) (J.ImmunoL, 148(5):1499 (1992)) using two different methods. A mixture containing an equal amount of each was used as the unmunogen.
1) 23 mg of Dithiothreitol (DTT), and 200 meg of cysteine coupled TCE (J.Immunol.,
148(5): 1499 (1992)) are mixed at room temperature for 30 minutes. DTT is removed by
centrifugation through a SephadexOlO (Pharmacia, Upsala, Sweden) chromatography column.
The reduced cysteine coupled TCE is added to 200 meg soluble extracellular domain of human
EpoR (R&D Systems, Minneapolis, MM) re-suspended in Phosphate Buffered Saline (PBS)
(8.1 mM Na2HPO4, 1.6 mM NaHaPCv, 136 mM NaCl, 2.6 mM KC1, pH 7.4) and 33 meg of
Sulfosuccinimidyl 4-(N-maleimidomethyl)-cyclohexane-l-carboxylate (sulfo SMCC), and
mixed 4°C over night. Un-reacted EpoR was removed by centrifugation through a lOKDa cut
off Centricon column (Millipore, Bedford, MA).
2) The soluble extracellular domain (200 meg) of human EpoR (R&D Systems,
Minneapolis, MM) was re-suspended in PBS and mixed with 4 meg of TCE-BPA (p-Benzoyl
Phenylalanine) and incubated under UV light (362 nM) at room temperature for 45 minutes.
The un-reacted EpoR was removed by centrifugation through a lOKDa cut off Centricon
column (Millipore, Bedford, MA).
Immunisation of animals. Monoclonal antibodies of the invention, including Abl2 and Abl98 (also referred to herein as AB-ABT2-XG2-012 and AB-ABT2-XG2-198, respectively) were developed by immum'Ting XenoMouse® mice (XenoMouse® XG2, Abgenix, Inc., Fremont, CA and Vancouver, BC) with soluble EpoR coupled to a TCE as described above. The initial immunization was with 20 meg of antigen and mixed 1:1 v/v with Complete Freund's Adjuvant (CFA) (Sigma, St Louis, MO) per mouse. The subsequent immunizations were with 20 meg of antigen mixed 1:1 v/v with incomplete Freund's (IF A). In particular, each animal was immunized at the base of tail and by intraperitoneal injection on days 0,14,28 and 42.
Biotinvlation of EpoR. 300 meg of EpoR (Abbott CHO cell derived ref.# RB69084:4) was re-suspended in 990 mcL of PBS pH 8.6 and added to 100 meg of biotin-NHS (Pierce, Rockford, 111) dissolved in DMSO (Dimethyl Sulfoxide) incubated for forty minutes at room temperature (RT). Free biotin and buffer was removed by centrifugation through a SkDa Centricon column with several washes with PBS pH 7.4 and re-suspended in an appropriate volume to a final concentration was 600 mcg/mL.
Selection of animals for harvest Anti-EpoR antibody there were determined by ELISA. 0.7 meg/ml biotin EpoR (described above) was coated onto streptavadin plates (Sigma, St Louis, MO) at room teperature for 1 hour. The solution containing unbound biotin EpoR was removed and all plates were washed five times with dKbO. XenoMouse® sera from the EpoR immunized animals, or naive XenMouse® animals, were titrated in 2%milk/PBS at a 1:2 dilution in duplicate from a 1:100 initial dilution. The last well was left blank, and plates were washed five times with dH2O. A goat anti-human IgG PC-specific horseradish peroxidase (HRP)(Pierce, Rockford, IL) conjugated antibody was added at a final concentration of 1 mcg/mL for 1 hour at room temperature. The plates were washed five times with dHaO. The plates were developed with the addition of TMB chromogenic substrate (KPL, Gaithersburg, MD) for 30 minutes and the ELISA was stopped by the addition of 1 M phosphoric acid. The specific tilers obtained from XenoMouse® animals were determined from the optical density at 450 run and are shown in Table 1. The titer represents the reciprocal dilution of the serum and therefore the higher the number the greater the humoral immune response to EpoR.
Table 1
(Table Removed)
XenoMouse® animal 14 was selected for harvest based on the serology data in Table 1.
Culture and selection of B cells. B cells from die harvested animals were cultured and those secreting EpoR-specific antibodies were isolated essentially as described in Babcook et al., Proc. Natl Acad Sci. USA, 93:7843-7848 (1996). ELISA, performed as described above for sera illers, was used to identify EpoR-specific wells. Fifty plates cultured at 500 cells/well were screened on biotin EpoR to identify the antigen-specific wells. The data as shown in Table 2 demonstrated the presence of 701 wells with Ods significantly over background (0.05).
Table 2
(Table Removed) These data indicated a very low frequency of hits and indicated that the wells were monoclonal for antigen-specificity. These 701 positive wells were re-screened on biotin EpoR and 137 wells (shown hi bold in Table 3 below) were found to repeat as real antigen-specific wells with ODs significantly over background (0.05).
Table3
(Table Removed) Agonist activity assay. Proliferation of an Epo responsive cell line was used as the basis for the agonist screen. These 137 wells were then screened for agonist activity using the
hurfn eiytbroleukemia cell line UT-7/Epo (Abbott re».RB2y4i4-l 74;. U.5 mcL of supernatant were added to 1 x 105 cells per well in RPMI1640 (10% PCS) to a final volume of• 50 mcL in a half-area 96 well plate. The well size is half the area of a typical 96 well plate. Proliferation was identified visually and compared to cells in media containing a titration of human Epo or no Epo as a base line control. Eleven wells with proliferation activity were identified.
EpoR-specific Hemolytic Plaque Assay. A number of specialized reagents are needed to conduct the assay. These reagents were prepared as follows.
Biotinvlation of Sheep red blood cells (SRBC)'. SRBC are stored in RPMI media as a 25% stock. A 250ul SRBC packed-cell pellet was obtained by aliquoting 1.0 ml of the stock into a 15-ml falcon tube, spinning down the cells and removing the supernatant The cell pellet was then re-suspended in 4.75 ml PBS at pH 8.6 in a 50 ml tube. In a separate 50ml tube, 2.5 nig of Sulfo-NHS biotin was added to 45 ml of PBS at pH 8.6. Once the biotin had completely dissolved, 5 ml of SRBCs were added and the tube rotated at RT for 1 hour. The SRBCs were centrifuged at 3000g for 5 mm3 the supernatant drawn off and 25 mis PBS at pH 7.4 as a wash. The wash cycle was repeated 3 times, then 4.75 ml immune cell media (RPMI 1640 with 10% PCS) was added to the 250 ul biotinylated-SRBC (B-SRBC) pellet to gently re-suspend the B-SRBC (5% B-SRBC stock). Stock was stored at 4° C until needed.
Streptavidin fSA) coating of B-SRBC: One ml of the 5% B-SRBC stock was transferred into to a fresh eppendorf tube. The B-SRBC cells were pelleted with a pulse spin at 8000 rpm (6800 rcf) in a rnicrofuge, the supernatant drawn off, the pellet re-suspended in 1.0 ml PBS at pH 7.4, and the centrifugation repeated. The wash cycle was repeated 2 times, then the B-SRBC pellet was resuspended in 1.0 ml of PBS at pH 7.4 to give a final concentration of 5% (v/v). 10 ul of a lOmg/ml Streptavidin (CalBiochem, San Diego, CA) stock solution was added and the tube mixed and rotated at RT for 20min. The washing steps were repeated and the SA-SRBC were re-suspended in 1ml PBS pH 7.4 (5% (v/v)).
EpoR coating of SA-SRBC: The SA-SRBC were coated with biotmylated EpoR at lOug/ml, the mixed and rotated at RT for 20 min. The SRBC were washed twice with 1.0 ml
at pH 7.4 as above. The EpoR-coated SRBC were re-suspended in RPMI (+10%FCS) to a final concentration of 5% (v/v).
Determination of the quality ofEpoR-SRBC by immunofluorescence (IF): 10 ul of 5% SA-SRBC and 10 ul of 5% PTH-coated SRBC were each added to separate fresh 1.5 ml eppendorf tube containing 40ul of PBS. The murine anti-EpoR antibody (R&D Systems CaL# MAB307) was added to each sample of SRBCs at 20ug/ml. The tubes were rotated at RT for 25 min, and the cells were then washed three times with lOOul of PBS. The cells were re-suspended in 50ul of PBS and incubated with 40 mcg/mL Gt-anti mouse IgG Fc antibody conjugated to Alexa488 (Molecular Probes, Eugene, OR). The tubes were rotated at RT for 25 min, and men washed with lOOul PBS and the cells re-suspended in 10 ul PBS. lOul of the stained cells were spotted onto a clean glass microscope slide, covered with a glass coverslip, observed under fluorescent light, and scored on an arbitrary scale of 0-4.
Preparation of plasma cells: The contents of a single microculture well identified by the previous assays as containing a B cell clone secreting the immunoglobulin of interest were harvested. Using a 100-1000 ul pipettman, the contents of the well were recovered by adding 37C RPMI (+10% PCS). The cells were re-suspended by pipetting and then transfered to a fiesh 1.5 ml eppendorf tube (final vol. approx 500-700ul). The cells were cennifuged in a microruge at 1500 rpm (240 rcf) for 2 minutes at room temperature, then the tube rotated 180 degrees and spun again for 2 minutes at 1500 rpm. The freeze media was drawn off and the immune cells resuspended in 100 ul RPMI (10% PCS), then centrifuged. This washing with RPMI (10% PCS) was repeated and the cells re-suspended in 60ul RPMI (PCS) and stored on ice until ready to use.
'ague assay. Glass slides (2x3 inch) were prepared in advance with silicone edges and allowed to cure overnight at RT. Before use the slides were treated with approx. 5ul of SigmaCoat (Sigma, Oakville, ON) wiped evenly over glass surface, allowed to dry and then wiped vigorously. To a 60ul sample of cells was added 60ul each of EpoR-coated SRBC (5% v/v stock), 4x guina pig complement (Sigma, Oakville, ON) stock prepared in RPM1 with 10% PCS, and 4x enhancing sera stock (1:900 in RPMI with 10% PCS). The mixture (3 - 5ul) was spotted onto the prepared slides and the spots covered with undiluted paraffin oil. The slides were incubated at 37° C for a minimum of 45 minutes.
Plaque assay results: The coating was determined qualitatively by immunofluorescent microscopy to be very high (4/4) using MAB307 to detect coating compared to a secondary detection reagent alone (0/4). There was no signal detected using the MAB307 antibody on red blood cells mat were only coated with streptavidin (0/4). These red blood cells were then used to identify antigen-specific plasma cells from the fourteen wells identified in Table 4. After micromanipulation to rescue the antigen-specific plasma cells, the genes encoding the variable region genes were rescued by RT-PCR on a single plasma cell.
Table 4
(Table Removed) Expression. After isolation of the single plasma cells, mRNA was extracted and reverse transcriptase PCR was conducted to generate cDNA. The cDNA encoding the variable heavy and light chains was specifically amplified using polymerase chain reaction. The variable heavy chain region was cloned into an IgG2 expression vector. This vector was generated by cloning the constant domain of human IgG2 into the multiple cloning she of pcDNA3.14VHygro (Invitrogen, Burlington, ON). The variable light chain region was cloned into an IgK expression vector. This vector was generated by cloning the constant domain of human IgK into the multiple cloning site of pcDNA3.1+/Neo (Invitrogen, Burlington, ON). The appropriate pairs of heavy chain and the light chain expression vectors were then co-lipofected into a 60 mm dish of 70% confluent human embryonal kidney 293 cells and the transfected cells were left to secrete a recombinant antibody for 24 hours. The supernatant (3 mL) was harvested from the HEK 293 cells and the secretion of an intact antibody (AB-ABT2-XG2-012 and AB-ABT2-XG2-198) was demonstrated with a sandwich ELISA to specifically detect human IgG (Table 5, fourth column). The specificity of AB-ABT2-XG2-012 and AB-ABT2-XG2-198 was assessed through binding of the recombinant antibody to biotinylated EpoR using ELISA (Table 5, fifth column).
Table5
(Table Removed) Ine ELISA for antigen specific antibody secretion was performed as follows. Control plates were coated with 2mg/mL Goat anti-human IgG H+L 0/N. For the binding plates, biotin-EpoR (0.7 mcg/mL) was coated onto streptavadin 96 well plates (Sigma, St Louis, MO) for one hour at room temperature. The plates were washed five times with dHbO. Recombinant antibodies were titrated 1:2 for 7 wells from the undiluted minilipofection supernatant The plates were washed five times with dH2O. A goat anti-human IgG Fc-specific HRP-conjugated antibody was added at a final concentration of 1 ug/mL for 1 hour at RT for the secretion and the binding ELISA. The plates were washed five times with dH2O. The plates were developed with the addition of TMB chromogenic substrate (KPL, Gaithersburg, MD) for 30 minutes and the ELISA was stopped by the addition of 1 M phosphoric acid. Each ELISA plate was analyzed to determine the optical density of each well at 450 run.
Purification of AB-ABT2-XG2-012 and AB-ABT2-XG2-198. For larger scale production, the heavy and light chain expression vectors (2.5 ug of each chain/dish) were lipofected into ten 100 mm dishes that were 70% confluent with HEK 293 cells. The transfected cells were incubated at 37°C for 4 days, the supernatant (6 mL) was harvested and replaced with 6 mL of fresh media. At day 7, the supernatant was removed and pooled with the initial harvest (120 mL total from 10 plates). The ABT2-XG2-012 and ABT2-XG2-198 antibody were purified from the supernatant using a Protein-A Sepharose (Amersham Biosciences, Piscataway, NJ) affinity chromatography (1 mL). The antibody was eluted from the Protein-A column with 500 mcL of 0.1 M Glycine pH 2.5. The eluate was dialysed in PBS pH 7.4 and filter sterilized. The antibody was analyzed by non-reducing SDS-PAGE to assess purity and yield.
Agonist activity of recombinant antibodies. The ability of these recombinant antibodies to stimulate the proliferation of Epo responsive cells was examined using the UT-7/Epo cells with proliferation quantitated by MTS reagent (Promega, Madison, WI) measured at 490 nm as described in the Agonist Activity Assay above. ABT2-SCX-012 and ABT2-SCX-198 induced proliferation in comparison to cells in media without antibody and are shown below (Fig. 14 and 15 respectively).
Effect of anti-Human Fc. It is possible that the agonist activity of ABT2-SCX-012 and ABT2-SCX-198 are due to self-aggregation. In older to address this issue we induced aggregation by the addition of an anti-human Fc secondary antibody and the effect on the agonist activity of ABT2-SCX-012 and ABT2-SCX-198 was determined using the UT-7/Epo cells. As shown below the addition of a secondary antibody had no effect on the activity of ABT2-SCX-198 (Fig. 16) and inhibited the activity of ABT2-SCX-012 (Fig. 4 17).
Since the addition of secondary Ab inhibited the activity of ABT2-SCX-012 we concluded that aggregation of this antibody interferes with ifs activity and thus it is unlikely that ABT2-SCX-012 has agonist activity due to aggregation. However, the results of ABT2-SCX-198 are more difficult to interpret The lack of an effect could suggest that ABT2-SCX-198 is fully aggregated and thus the addition of secondary Ab has no further effects on its activity. Alternatively, the lack of effect suggests the activity of ABT2-SCX-198 is not perturbed by the confonnational restrictions applied by a secondary antibody.
Sequence analysis of ABT2-SCX-012 and ABT2-SCX-198 The variable heavy chains and the variable light chains for antibodies ABT2-SCX-012 and ABT2-SCX-198 were sequenced to determine their DNA sequences. The complete sequence information for the anti-EpoR antibodies shown in Figures 1, 2, and 18-30 with nucleotide and ammo acid sequences for each variable region of the heavy chain gamma and kappa light chains. Figures 1 and 2 provide full-length sequences, including the constant regions.
The variable heavy sequences were analyzed to determine the VH family, the D-region sequence and the J-region sequence. The sequences were then translated to determine the
/
primary arnino acid sequence (Fig.29) and compared to the gennline VH, D and J-region sequences to assess somatic hypermutations. The primary arnino acid sequences of all the anti-EpoR antibody gamma chains are shown in Figure 16. The gennline sequences are shown above and the mutations are indicated with the new arnino acid sequence. Unaltered amino acids are indicated with a dash (-). The light chain was analyzed similarly to determine the V and the J-regions and to identify any somatic mutations from gennline kappa sequences (Figure 30). The heavy chain of ABT2-SCX-012 was shown to utilize the VH 4-59 (DP-71), DIR4rc and the JH4a gene segments, while the light chain was shown to use the Vkl (A30) and
the Jkl gene segments. The heavy chain of ABT2-SCX-198 was shown to utilize the VH 3-30 (V3-30), D4-23 and the JH6b gene segments, while the light chain was shown to use the Vkl
o
(LS) and the Jk3 gene segments.
EXAMPLE 2: Competition of Abl2 with 125I-Labeled EPO for Binding CHO Cells Expressing Recombinant EPO Receptor
I
CHO cells expressing the full length recombinant human EPO receptor were plated at SxlO5 cells/well in 24 well plates 72 hours prior to the assay. On the day of the assay, 9Sul of Abl2, Abl98, or EPO at indicated concentrations (shown in Figure 5) diluted in RPMI1640, 0.5% BSA, ImM NaN3 and 5 ul (6ng) of 125I-EPO (Amersham Cat #IM178, Arlington Heights,IL 486ci/mM) were added to the wells. After incubating at 37°C for 1.5 hours, the wells were washed three times with cold HBSS and harvested using 0.5ml 0.1N NaOH. Samples were counted in a Micromedic ME Plus gamma counter. The results are shown in Figure 5. Specifically, the results show that Abs 12 and 198 competed with EPO for binding to the erythropoietin receptor.
EXAMPLES: BiacoreStudies
The studies described below were performed on a Biacore 2000 utilizing the Biacontrol software version 3.1. (Biacore, Uppsala, Sweden). Binding analyses were performed with antibody immobilized directly to the chip surface and followed by injection of varying receptor concentrations.
Immobilization of Antibody
Immobilizations of antibody were performed using the default immobilization program in the Biacore software package. Antibodies were diluted to 10 ug/mL in the supplied acetate buffers to prescreen for the appropriate pH at which to conduct the immobilizations. For immobilizations, antibodies were diluted into the appropriate acetate buffer (10 mM acetate pH 4.0) and coupled directly to the chip surface using standard EDC chemistry at three different protein levels (500,1000, and 1500 RU). The fourth flow cell was mock coupled with EDC to cap the carboxyl groups and provide a background surface as a negative control.
[studies
Binding studies were performed by successive injections of varying concentrations of soluble human EPO receptor over the chip surface (500 RU immobilized protein). Binding analyses were performed in the supplied HBS-EP buffer [HBS buffer -10 mM HEPES pH -7.4,150 mM NaCI, 3 mM EDTA, 0.005% Polysorbate 20 (v/v), Biacore] using receptor diluted to the desired concentrations (10 - 200 nM) using the running buffer (HBS-EP). Experiments were performed at a flow rate of 30 uL/min. The receptor was injected over a period of 3 minutes followed by a 15 minute dissociation period. Simultaneous injections over the flow cell created as a negative control were also performed. All injections were performed in triplicate. '
Model fitting
Data were fit to the models available in the BiaEvaluation 3.0.2 software package (Biacore). The data points from the experimental injections were corrected by subtraction of data points from simultaneous over the negative control surface. The corrected data were used to fit to the 1:1 (Langmuir) binding model as well as the bivalent analyte model available in the BiaEvaluation software package. Dissociation constants were calculated directly from fitting to the Langmuir binding model. For the bivalent analyte model, the dissociation constants were calculated indirectly using the calculated values for the kinetic dissociation and kinetic association constants, kj and k*
Table 6
(Table Removed) EXAMPLE 4: EPO Dependent Human Cell Proliferation Assay Stock cultures of the human ervthroleukemic cell line, F36E cells were maintained in RPMI1640 media with 10% fetal bovine serum and 1 unit per mL of recombinant human erythropoietin. Prior to assays, cells were cultured overnight at a density of 4.0 to 5.0 x 105 cells per mL in growth medium without EPO. Cells were recovered, washed and resuspended
at a dmsity of 1.0 x 106 cells per mL in assay medium (RPMI1640 + 10% FBS) and 50 uL of cells added to wells of a 96 well microtiter plate. 50 uL of each of Abl2, Ab 390, Ab 412, Ab 467, Ab 484, Ab 430/432 and Abl98 or EPO standards (recombinant human EPO (rHuEPO)) ^rassay medium were added to wells and the plates were incubated in a humidified incubator at 37°C with a 5% CCb atmosphere. After 72 hours, 20 uL of Promega Cell liter 96 Aqueous® reagent (as prepared per manufacturer's instructions, Madison, Wisconin) was added to all wells. Plates were incubated at 37°C with a 5% COa atmosphere for 4 hours and the optical density at 490 run was determined using a microplate reader (Wallac Victor 1420 Multilabel Counter, Wallac Company, Boston, MA). The results are shown in Figure 6. All Abs stimulated proliferation of the F36E cell line. Maximal proliferative activity was similar to that observed with the EPO control and shown by a bell shaped curve as concentration increased. The results in Figure 7 demonstrate that Abl2, after storage at 4°C for up to 20 days, is active in inducing the proliferation of F36E cells. Proliferative activity was similar to that observed with the EPO control with the maximal response differing about ten-fold on a molar equivalent basis
EXAMPLE 5: Human CD36+ CFUe Assay
Frozen human CD36+ erythroid progenitor cells obtained from Poietics (Biowhittaker (Walkersville, MD» were thawed and 104 cells/ml in IMDM-2%FBS. Cells (03 ml) were added to 0.3 ml tubes containing 2.4 ml Methocult (StemCell Technologies, Vancouver, Canada) Cat #04230), 0.3 ml stem cell growth factor (Sigma, St. Louis, Missouri Cat #S7901, lOOug/ml), and 0.3 ml EPO (R&D Systems), Ab 12, or IMDM-2% FBS. After mixing, 1.1 ml of the Methocult suspension was added to a 35 mm non tissue culture treated sterile petri dish and incubated at 37°C, 5% COz for 2 weeks. Colonies were identified microscopically. The results are shown in Figure 8. Specifically, Abl2 induced the formation of CFU-E colonies
from human
CD 36+ progenitor cells. The colonies, identified microscopically, were red in color. The size and number of the colonies is reduced compared to those observed with the EPO control probably due to a reduced proliferative signal.
EXAMPLE 6: Demonstration of Erythopoietic Activity in Liquid Cultures
CD34+ cells were enriched from human peripheral blood using a Direct CD34+
Progenitor Cell Isolation Kit (Miltenyi, Auburn, CA). Recovered cells were washed twice with
alnta-medium and re-suspended in suspension culture media (alpha-media supplemented with 30% PCS, 1% deionized BSA, 10~5M p-mercaptoethanol, 10"6 M dexamethasone, 0.3 mg/mL • human hollo-transferrin and 10 ng/mL human recombinant stem cell factor). Cells were plated out at a density of 1 x 104 cells/mL in duplicates in 6-well microplates with test antibody at concentrations ranging from 0.1 -100 ng/mL. Plates were incubated at 37°C and 5% COz for two weeks. Duplicate samples from each well were recovered for cell counts and staining with benzidine (Reference Fibacb, E., 1998 Hemoglobin, 22:5-6,445-458).
The results are shown in Figure 9. Specifically, Abl98 induced the proliferation of human erythroid producing cells derived from progenitor cells in a dose dependent manner. The number of proliferating cells and the percentage expressing hemoglobin, as indicated by staining with benzidine, was reduced compared to the EPO treated controls again probably due to a reduced proliferative signal.
EXAMPLE 7: Cynomolgus Bone Marrow CFUe Assay
Bone marrow was harvested from cynomolgus monkeys and diluted 1:2 with PBS. Three ml of the diluted bone marrow was layered over six ml of Lymphoprep (Gibco (Invitrogen), Carlsbad, CA Cat #1001967), centrifuged at 2700rpm for 20 minutes and the bufiy coat recovered and diluted in 10ml IMDM-2%FBS. Cells were centrifuged and resuspended at 106cells/ml in IMDM-2%FBS. Cells (0.3 ml) were added to tubes containing 2.4 ml Methocult (StemCell Technologies, Vancouver, Canada) Cat #04230), 0.3 ml stem cell growth factor (Sigma, Cat #S7901,100 ug/ml), 0.3 ml EPO (R& D Systems, Minneapolis, Minnesota), test antibody (Abl98), or IMDM-2%FBS. After mixing, l.lml of the Methocult suspension was added to a 35mm non tissue culture treated sterile petri dish and incubated at 37°C, 5%COa for 2 weeks. Colonies were identified microscopically. The results of this assay are shown in Figure 10 demonstrate that Abl98 induced the formation of CFU-E colonies (although the number of colonies was reduced compared to that observed with the EPO control).
EXAMPLES: ELIS A to Measure Binding of SE-3 Peptide
96 well polystyrene plates (Dynatec (Elk Grove Village, IL) Immunolon 4) were coated with 80 ul of Sug/ml soluble EPO receptor (sEPOR) (R&D Systems (Minneapolis, MN) Cat #307-ER/LF), orpeptide SE-3 (PGNYSFSYQLEDEPWKLCRLHWAPTARGAV) (described
in U.S. Patent 6,319,499) diluted in 0.015M Na2CO3,0.035M NaHCO3, pH 9.4 for 2 hours at rooffc temperature and overnight at 4°C. Plates were blocked for 30 minutes at room temperature with 100 ul of 5%BSA in PBS (Gibco (Invitrogen (Carlsbad, CA)) Cat#10010). After removal of blocking solution, 50 ul of Abl2 at 5 ug/ml in PBS with 1% BSA was added to wells and plates were incubated at room temperature for 2 hours. Plates were washed three times using a Skatron 400 Plate Washer with PBS/0.05% Tween 20 and 50 ul of secondary antibody diluted in PBS/0.25%BSA/0.05%Tween 20 added to the wells. For Abl2, goat anti-human IgG (Fc)-HRP (Caltag (Buriingame, CA) Cat#H 105 07) diluted 1:1000 was used and for Ab 71A (available from the American Type Culture Collection
HB11689, also described in U.S. Patent 6,319,499), goat anti mouse IgG (Fc>HRP (Jackson Laboratories (West Grove, PA) CaL#115-035-l64) diluted 1:5000 was used. After a 1 hour incubation at room temperature, plates were washed three times as before and 50 ul of OPD Developing Reagent (Sigma #P9187) added to each well. Color development was stopped by addition of 50ul of IN HC1 to the wells and optical density measured at 490nm on a Victor 1420 Multi-Label Counter.
Figure 11 shows that Abl2 does not interact (i.e. bind) with SE-3 peptide. Ab 71A does interact (i.e. binds) with the SE-3 peptide Both Abs 12, and 71A interacted with immobilized erytbropoietin receptor.
EXAMPLE 9: EPO Dependent Proliferation Assay
Primary hybridoma supematants were diluted in assay medium and tested for their ability to stimulate the proliferation of the F36E human erythroleukemic cells as described in EXAMPLE 5. Results with five primary supematants are shown in Figure 12. These samples stimulated the proliferation of F36E cells .
EXAMPLE 10: ELISA to Measure Binding of Hybridoma Supematants to SE-3 Peptide
Forty-two primary hybridoma supematants were tested for their ability to bind to either immobilized EPO receptor or peptide SE-3 as described in EXAMPLE 10. Figure 13 shows that whereas all the hybridoma supematants tested interact with immobilized EPO receptor, only sample 16 interacted with SE-3 peptide at levels above background.
EXAMPLE 11: Comparison of Erythropoietic Activity of
Gamma-1 Abl2 versus Gamma-2 Abl2
Proliferation assays (as described in Example 4) were performed to compare the aythropoietic activity of gamma-1 Ab 12 and gamma-2 Ab 12 on F36e human aythroleukemic cells. The results are shown in Figure 31. As Figure 31 shows, gamma-2 Ab 12 was more effective at stimulating proliferation of the F36E cell line than gamma-1 Ab 12.
EXAMPLE 12: Effect of Ab 12 on Ervthropoiesis in vivo
(a) Construction of mEpoR-/-, hEopR + transgenic mice: Transgenic mice that
produced only human EpoR (hEpoR+, single allele) and no endogenous mouse EpoR (mEpoR
-/-, double allele mutation) were generated as described in Liu, C. et al., Jounal of Biological
Chemistry, 272:32395 (19971 and Yu, X., et al, Blood. 98(2):475 (2001). Breeding colonies
were established to generate mice for in vivo studies of eryhthropoiesis.
(b) Multiple dosing regimen: In initial experiments, animals were subjected to a
multiple dosing regimen of Ab 12 to determine whether the antibody would cause an increase
in reticulocyte counts and/or % hematociiL Five transgenic mice (mEpoR -/-, h£poR+, were
injected subcutaneously with either 5 ug or 50 ug of Ab 12 in 0.2 mL vehicle (phosphate
buffered saline [PBS] containing 0.1% bovine serum albumin ([BSA]). Control animals also
were injected in the same manner with equal volumes of the vehicle alone or vehicle
containing 5U Epogen* (Amgen®, Thousand Oaks, CA). All animals were dosed over a three-
week period in accordance with the following schedule:
(Table Removed)
Sample bleeds were taken on day 4 (Thursday of week 1) for determining reticulocyte counts and on day 19 (Friday of week 3) for determining hematocrits. Reticulocyte counts and hematocrit determinations were made using methods well known in the art As Figure 32 shows, Ab 12 caused a statistically significant increase (over controls) in reticulocyte count and % hematocrit in animals receiving either 5 or 50 ug of Ab 12 antibody.
(c) Weekly dosing regimen: To assess whether the results seen under a multiple dosing regimen still would be observed in animals receiving fewer doses of Ab 12, transgenic mice were injected (as described in (b) above) with varying concentrations (0.5,2.5, 5.0,50 and 250 p.g) of Ab 12 or a control, Aranesp™ (Amgen®, Thousand Oaks, CA), a more active variant of Epogen® on days 1, 8 and 15 and bled on days 4 and 19 for determination of
reticulocyte count and hematocrit, respectively. Control animals received a single dose of vefflde only or a human IgG2 isotype control. Figure 33 shows that Ab 12 caused a statistically significant increase (over vehicle and isotype controls) in pecent hematocrit with all but the lowest concentrations tested.
(d) Single versus weekly dosing regimens: To determine whether a single dose of Ab-12 would have an effect on erymropoiesis after 3 weeks, transgenic mice were dosed with Ab 12 (SO ug), at one week intervals for 3 weeks or with a single dose of Ab 12 (150 ug) and bled on day 19 for determination of percent hematocrit. Control animals received vehicle alone, a single dose of Aranesp™ (900 ng) or 3 total doses of Aranesp™ injected at weekly intervals (300 ng x 3). Figure 34 shows that both dosing regimens of Ab 12 caused a statistically significant increase in percent hematocrit over the vehicle control. In contrast, the single dose regimen of Aranesp™ did not have this effect
All abstracts, references, patents and published patent applications referred to herein are hereby incorporated by reference.
The present invention is illustrated by way of the foregoing description and examples. The foregoing description is intended as a non-limiting illustration, since many variations will become apparent to those skilled in the art in view thereof.
Changes can be made to the composition, operation and arrangement of the method of the present invention described herein without departing from the concept and scope of the invention.
We claim:
1. An antibody or antibody fragment thereof that activates an endogenous activity of a human erythropoietin receptor in a mammal wherein said antibody or antibody fragment is Abl2 (ATCC Accession No. PTA-5554).
2. The antibody or antibody fragment as claimed in claim 1 wherein said antibody or antibody fragment is a monoclonal antibody.
3. The antibody or antibody fragment as claimed in claim 2 wherein said antibody or antibody fragment is selected from the group consisting of Ab3, Abl2, Ab22, Ab54, Ab60, Abl02, Abl35, Abl45, Abl98, Ab254, Ab267, Ab390, Ab412, Ab430/432, Ab467 and Ab484.
4. A pharmaceutical composition comprising a therapeutically effective amount such as
herein described of the antibody or antibody fragment as claimed in claims 1-3 and a
pharmaceutically acceptable excipient.
| # | Name | Date |
|---|---|---|
| 1 | 2062-delnp-2005-petition-138.pdf | 2011-08-21 |
| 2 | 2062-delnp-2005-petition-137.pdf | 2011-08-21 |
| 3 | 2062-delnp-2005-pct-401.pdf | 2011-08-21 |
| 4 | 2062-delnp-2005-pct-318.pdf | 2011-08-21 |
| 5 | 2062-delnp-2005-pct-304.pdf | 2011-08-21 |
| 6 | 2062-delnp-2005-pct-301.pdf | 2011-08-21 |
| 7 | 2062-delnp-2005-pct-220.pdf | 2011-08-21 |
| 8 | 2062-delnp-2005-pct-210.pdf | 2011-08-21 |
| 9 | 2062-delnp-2005-pct-111.pdf | 2011-08-21 |
| 10 | 2062-delnp-2005-pct-101.pdf | 2011-08-21 |
| 11 | 2062-delnp-2005-gpa.pdf | 2011-08-21 |
| 12 | 2062-delnp-2005-form-5.pdf | 2011-08-21 |
| 13 | 2062-delnp-2005-form-3.pdf | 2011-08-21 |
| 14 | 2062-delnp-2005-form-2.pdf | 2011-08-21 |
| 15 | 2062-delnp-2005-form-18.pdf | 2011-08-21 |
| 16 | 2062-delnp-2005-form-1.pdf | 2011-08-21 |
| 17 | 2062-delnp-2005-description (complete).pdf | 2011-08-21 |
| 18 | 2062-delnp-2005-correspondence-po.pdf | 2011-08-21 |
| 19 | 2062-delnp-2005-correspondence-others.pdf | 2011-08-21 |
| 20 | 2062-delnp-2005-complete specification (granted).pdf | 2011-08-21 |
| 21 | 2062-delnp-2005-complete specification (as,files).pdf | 2011-08-21 |
| 22 | 2062-delnp-2005-claims.pdf | 2011-08-21 |
| 23 | 2062-delnp-2005-assignment.pdf | 2011-08-21 |
| 24 | 2062-delnp-2005-abstract.pdf | 2011-08-21 |
| 25 | 2062-DELNP-2005-GPA-(10-10-2011).pdf | 2011-10-10 |
| 26 | 2062-DELNP-2005-Correspondence Others-(10-10-2011).pdf | 2011-10-10 |