Abstract: The present invention relates to exendin-4 derivatives and their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as reduction of excess food intake.
Exendin-4 Derivatives as dual GLP1/GIP or trigonal GLP1/GIP/Glucagon
Agonists
Description
FIELD OF THE INVENTION
The present invention relates to exendin-4 peptide analogues which activate the glucagon-like peptide 1 (GLP-1 ) and the glucose-dependent insulinotropic polypeptide (GIP) receptor and optionally the glucagon receptor (GCG) and their medical use, for example in the treatment of disorders of the metabolic syndrome, including diabetes and obesity, as well as reduction of excess food intake.
BACKGROUND OF THE INVENTION
Exendin-4 is a 39 amino acid peptide which is produced by the salivary glands of the Gila monster (Heloderma suspectum) (Eng J. et al., J. Biol. Chem., 267:7402-05,1992). Exendin-4 is an activator of the glucagon-like peptide-1 (GLP-1 ) receptor, whereas it shows only very low activation of the GIP receptor and does not activate the glucagon receptor (see Table 1 ).
Table 1 : Potencies of exendin-4 at human GLP-1 , GIP and Glucagon receptors (indicated in pM) at increasing concentrations and measuring the formed cAMP as described in Methods.
Exendin-4 shares many of the glucoregulatory actions observed with GLP-1 .
Clinical and non-clinical studies have shown that exendin-4 has several beneficial antidiabetic properties including a glucose dependent enhancement in insulin synthesis and secretion, glucose dependent suppression of glucagon secretion, slowing down gastric emptying, reduction of food intake and body weight, and an increase in beta-cell mass and markers of beta cell function (Gentilella R et al., Diabetes Obes Metab., 1 1 :544-56, 2009; Norris SL et al., Diabet Med., 26:837-46, 2009; Bunck MC et al., Diabetes Care., 34:2041 -7, 201 1 ).
These effects are beneficial not only for diabetics but also for patients suffering from obesity. Patients with obesity have a higher risk of getting diabetes, hypertension, hyperlipidemia, cardiovascular and musculoskeletal diseases.
Relative to GLP-1 and GIP, exendin-4 is more resistant to cleavage by dipeptidyl peptidase-4 (DPP4) resulting in a longer half-life and duration of action in vivo (Eng J., Diabetes, 45 (Suppl 2):152A (abstract 554), 1996; Deacon CF, Horm Metab Res, 36: 761 -5, 2004).
Exendin-4 was also shown to be much more stable towards degradation by neutral endopeptidase (NEP), when compared to GLP-1 , glucagon or oxyntomodulin (Druce MR et al., Endocrinology, 150(4), 1712-1721 , 2009).
Nevertheless, exendin-4 is chemically labile due to methionine oxdiation in position 14 (Hargrove DM et al., Regul. Pept., 141 : 1 13-9, 2007) as well as deamidation and isomerization of asparagine in position 28 (WO 2004/035623).
The amino acid sequence of exendin-4 is shown as SEQ ID NO: 1
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
The amino acid sequence of GLP-1 (7-36)-amide is shown as SEQ ID NO: 2:
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
Liraglutide is a marketed chemically modified GLP-1 analogue in which, among other modifications, a fatty acid is linked to a lysine in position 20 leading to a prolonged duration of action (Drucker DJ et al, Nature Drug Disc. Rev. 9, 267-268, 2010; Buse, JB et al., Lancet, 374:39-47, 2009).
The amino acid sequence of Liraglutide is shown as SEQ ID NO: 3:
HAEGTFTSDVSSYLEGQAAK((S)-4-Carboxy-4-hexadecanoylamino-butyryl-) EFIAWLVRGRG-OH
GIP (glucose-dependent insulinotropic polypeptide) is a 42 amino acid peptide that is released from intestinal K-cells following food intake. GIP and GLP-1 are the two gut enteroendocrine cell-derived hormones accounting for the incretin effect, which accounts for over 70% of the insulin response to an oral glucose challenge (Baggio LL, Drucker DJ. Biology of incretins: GLP-1 and GIP. Gastroenterology 2007; 132: 2131-2157).
GIP's amino acid sequence is shown as SEQ ID NO: 4:
YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ-OH
Glucagon is a 29-amino acid peptide which is released into the bloodstream when circulating glucose is low. Glucagon's amino acid sequence is shown in SEQ ID NO: 5:
HSQGTFTSDYSKYLDSRRAQDFVQWLMNT-OH
During hypoglycemia, when blood glucose levels drop below normal,
glucagon signals the liver to break down glycogen and release glucose, causing an increase of blood glucose levels to reach a normal level. Hypoglycemia is a common side effect of insulin treated patients with hyperglycemia (elevated blood glucose levels) due to diabetes. Thus, glucagon's most predominant role in glucose regulation is to counteract insulin action and maintain blood glucose levels.
Hoist (Hoist, J. J. Physiol. Rev. 2007, 87, 1409) and Meier (Meier, J. J. Nat. Rev. Endocrinol. 2012, 8, 728) describe that GLP-1 receptor agonists, such as GLP-1 , Liraglutide and exendin-4, improve glycemic control in patients with T2DM by reducing fasting and postprandial glucose (FPG and PPG). Peptides which bind and activate the GLP-1 receptor are described in patent applications WO 98/08871 A1 , WO2008/081418 A1 and WO2008/023050 A1 , the contents of which are herein incorporated by reference.
It has been described that dual activation of the GLP-1 and GIP receptors, e.g. by combining the actions of GLP-1 and GIP in one preparation, leads to a therapeutic principle with significantly better reduction of blood glucose levels, increased insulin secretion and reduced body weight in mice with T2DM and obesity compared to the marketed GLP-1 agonist Liraglutide (e.g. VA Gault et al., Clin Sci (Lond), 121 , 107-1 17, 201 1 ). Native GLP-1 and GIP were proven in humans following co-infusion to interact in an additive manner with a significantly increased insulinotropic effect compared to GLP-1 alone (MA Nauck et al., J. Clin. Endocrinol. Metab., 76, 912-917, 1993).
Designing hybrid molecules which combine agonism on the GLP-1 receptor, the GIP receptor and the glucagon receptor offers the therapeutic potential to achieve significantly better reduction of blood glucose levels, increased insulin secretion and an even more pronounced significant effect on body weight reduction compared to the marketed GLP-1 agonist Liraglutide (e.g. VA Gault et al., Clin Sci (Lond), 121 , 107-1 17, 201 1 ).
Compounds of this invention are exendin-4 derivatives, which show agonistic activity at the GLP-1 and the GIP receptor and optionally the glucagon receptor and which have - among others - preferably the following modifications: Tyr at position 1 and lie at position 12.
Surprisingly, it was found that the modification of the selective GLP-1 R agonist Exendin-4 by Tyr in position 1 and lie in position 12 results in a peptide with high dual activity at the GLP-1 and GIP receptors. This observation is surprising, since the same modification in other GLP-1 agonists, such as GLP-1 itself, does not result in high activity at the GIP receptor, as shown in Table 2.
Table 2: Potencies of exendin-4 and GLP-1 peptide analogues at GLP-1 and GIP receptors (indicated in pM) at increasing concentrations and measuring the formed cAMP as described in Methods.
Peptides which bind and activate both the GIP and the GLP-1 receptor and optionally the glucagon receptor, and improve glycaemic control, suppress body weight gain and reduce food intake are described in patent applications WO 201 1/1 19657 A1 , WO 2012/138941 A1 , WO 2010/01 1439 A2, WO 2010/148089 A1 , WO 201 1/094337 A1 , WO 2012/0881 16 A2, the contents of which are herein incorporated by reference. These applications disclose that mixed agonists of the GLP-1 receptor, the GIP receptor and optionally the glucagon receptor can be designed as analogues of the native GIP or glucagon sequences.
Compounds of this invention are exendin-4 peptide analogues comprising leucine in position 10 and glutamine in position 13. Krstenansky et al. (Biochemistry, 25, 3833-3839, 1986) show the importance of residues 10 to 13 of glucagon for its receptor interactions and activation of adenylate cyclase. In the exendin-4 peptide analogues of this invention, several of the underlying residues are different from said of glucagon. In particular, residues Tyr10 and Tyr13, are replaced by leucine in position 10 and glutamine, a non-aromatic polar amino acid, in position 13. This replacement, especially in combination with isoleucine in position 23 and glutamate in position 24 leads to exendin-4 derivatives with potentially improved biophysical properties as solubility or aggregation behavior in solution. The non-conservative replacement of an aromatic amino acid with a polar amino acid in position 13 of an exendin-4 analogue surprisingly leads to peptides with high activity on the GIP receptor and optionally on the glucagon receptor.
Furthermore, compounds of this invention are exendin-4 derivatives with fatty acid acylated residues in position 14. This fatty acid functionalization in position 14 results in an improved pharmacokinetic profile. Surprisingly, the fatty acid functionalization in position 14 also leads to peptides with a significantly higher GIPR activity.
BRIEF SUMMARY OF THE INVENTION
Provided herein are exendin-4 analogues which potently activate the GLP-1 and the GIP receptor and optionally the glucagon receptor. In these exendin-4 analogues - among other substitutions - methionine at position 14 is replaced by an amino acid carrying an -NH2 group in the side-chain, which is further substituted with a lipophilic side-chain (e.g. a fatty acid optionally combined with a linker).
The invention provides a peptidic compound having the formula (I):
R1 - Z - R2 (I)
wherein Z is a peptide moiety having the formula (II)
Tyr-Aib-X3-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-X12-Gln-X14-X15-X16- X17-X18-X19-X20-X21 -Phe-lle-Glu-Trp-Leu-Lys-X28-X29-Gly-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser-X40 (II)
X3 represents an amino acid residue selected from Gin, Glu and His, X12 represents an amino acid residue selected from lie and Lys,
X14 represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is functional ized by -C(O)-R5, -C(O)O-R5, -C(O)NH-R5, -S(O)2-R5 or R5, preferably by -C(O)-R5, wherein R5 may be a moiety comprising up to 50 or up to 100 carbon atoms and optionally heteroatoms selected from halogen, N, O, S and/or P,
X15 represents an amino acid residue selected from Asp and Glu, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Lys, lie, Glu,
Gin, Leu, Aib, Tyr and Ala,
X18 represents an amino acid residue selected from Ala, Arg, Lys, Aib, Leu and Tyr,
X19 represents an amino acid residue selected from Ala, Val, Gin and Aib,
X20 represents an amino acid residue selected from Gin, Aib, Phe, Leu, Lys, His, Arg, Pip, (S)MeLys, (R)MeLys, (S)MeOrn and (R)MeOrn, X21 represents an amino acid residue selected from Asp, Glu, Leu and Tyr,
X28 represents an amino acid residue selected from Asn, Ala, Arg, Lys,
Aib and Ser,
X29 represents an amino acid residue selected from Gly, Thr, Aib, D- Ala and Ala,
X40 is absent or represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is optionally functionalized by -C(O)-R5, -C(O)O-R5, -C(O)NH-R5, -S(O)2-R5 or R5, preferably by -C(O)-R5, wherein R5 may be a moiety comprising up to 50 or up to 100 carbon atoms and optionally heteroatoms selected from halogen, N, O, S and/or P,
R1 represents NH2,
R2 represents OH or NH2.
or a salt or solvate thereof.
The compounds of the invention are GLP-1 and GIP receptor agonists and optionally glucagon receptor agonists as determined by the observation that they are capable of stimulating intracellular cAMP formation. In vitro potency determination in cellular assays of agonists is quantified by determining the concentrations that cause 50% activation of maximal response (EC50) as described in Methods.
In certain embodiments, the invention therefore provides a peptidic compound having the formula (I):
R1 - Z - R2 (I)
wherein Z is a peptide moiety having the formula (II)
Tyr-Aib-X3-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-X12-Gln-X14-X15-X16- X17-X18-X19-X20-X21 -Phe-lle-Glu-Trp-Leu-Lys-X28-X29-Gly-Pro-Ser- Ser-Gly-Ala-Pro-Pro-Pro-Ser-X40 (II)
X3 represents an amino acid residue selected from Gin, Glu and His, X12 represents an amino acid residue selected from lie and Lys, X14 represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is functional ized by -C(O)-R5, -C(O)O-R5, -C(O)NH-R5, -S(O)2-R5 or R5, preferably by -C(O)-R5, wherein R5 is a moiety comprising up to 50 or up to 100 carbon atoms and optionally heteroatoms selected from halogen, N, O, S and/or P, X15 represents an amino acid residue selected from Asp and Glu, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Lys, lie, Glu, Gin, Leu, Aib, Tyr and Ala,
X18 represents an amino acid residue selected from Ala, Arg, Lys, Aib, Leu and Tyr,
X19 represents an amino acid residue selected from Ala, Val, Gin and
Aib,
X20 represents an amino acid residue selected from Gin, Aib, Phe, Leu, Lys, His, Arg, Pip, (S)MeLys, (R)MeLys, (S)MeOrn and (R)MeOrn, X21 represents an amino acid residue selected from Asp, Glu, Leu and Tyr,
X28 represents an amino acid residue selected from Asn, Ala, Arg, Lys, Aib and Ser,
X29 represents an amino acid residue selected from Gly, Thr, Aib, D-Ala and Ala,
X40 is absent or represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is optionally functionalized by -C(O)-R5, -C(O)O-R5, -C(O)NH-R5, -S(O)2-R5 or R5, preferably by -C(O)-R5, wherein R5 may be a moiety comprising up to 50 or up to 100 carbon atoms and optionally heteroatoms selected from halogen, N, O, S and/or P,
R1 represents NH2,
R2 represents OH or NH2.
or a salt or solvate thereof, wherein the peptidic compound has a relative activity of at least 0.04%, preferably at least 0.08%, more preferably at least 0.2% compared to that of natural GIP at the GIP receptor.
In addition, the peptidic compound, particularly with a lysine at position 14 which is further substituted with a lipophilic residue, exhibits a relative activity of at least 0.07%, preferably at least 0.1 %, more preferably at least 0.14%, more preferably at least 0.35% and even more preferably at least 0.4% compared to that of GLP-1 (7-36) at the GLP-1 receptor.
In addition, the peptidic compound, particularly with a lysine at position 14 which is further substituted with a lipophilic residue, exhibits a relative activity of at least 0.04% (i.e. EC50 < 000 pM), more preferably 0.08% (i.e. ECso < 500 pM) and even more preferably 0.2% (i.e. EC50 < 200 pM) compared to that of natural GIP at the GIP receptor (EC5o = 0.4 pM).
Optionally, in some embodiments, the peptidic compound, particularly with a lysine at position 14 which is further substituted with a lipophilic residue, exhibits a relative activity of at least 0.1 %, preferably at least 0.2%, more preferably at least 0.3%, more preferably at least 0.4% and even more preferably at least 0.5% compared to that of natural glucagon at the glucagon receptor.
The term "activity" as used herein preferably refers to the capability of a compound to activate the human GLP-1 receptor, the human GIP receptor and optionally the human glucagon receptor. More preferably the term "activity" as used herein refers to the capability of a compound to stimulate intracellular cAMP formation. The term "relative activity" as used herein is understood to refer to the capability of a compound to activate a receptor in a certain ratio as compared to another receptor agonist or as compared to another receptor. The activation of the receptors by the agonists (e.g. by measuring the cAMP level) is determined as described herein, e.g. as described in the examples.
According to one embodiment, the compounds of the invention have an EC50 for hGLP-1 receptor of 500 pM or less, preferably of 200 pM or less; more preferably of 150 pM or less, more preferably of 100 pM or less, more preferably of 90 pM or less, more preferably of 80 pM or less, more preferably of 70 pM or less, more preferably of 60 pM or less, more preferably of 50 pM or less, more preferably of 40 pM or less, more preferably of 30 pM or less, and more preferably of 20 pM or less.
According to one embodiment, the compounds of the invention have an EC50 for hGIP receptor of 500 pM or less, preferably of 200 pM or less; more preferably of 150 pM or less, more preferably of 100 pM or less, more preferably of 90 pM or less, more preferably of 80 pM or less, more preferably of 70 pM or less, more preferably of 60 pM or less, more preferably of 50 pM or less, more preferably of 40 pM or less, more preferably of 30 pM or less, and more preferably of 20 pM or less.
According to another embodiment, the compounds of the invention have optionally an EC5o for hGlucagon receptor of 500 pM or less, preferably of 200 pM or less; more preferably of 150 pM or less, more preferably of 100 pM or less, more preferably of 90 pM or less, more preferably of 80 pM or less, more preferably of 70 pM or less, more preferably of 60 pM or less, more preferably of 50 pM or less, more preferably of 40 pM or less, more preferably of 30 pM or less, and more preferably of 20 pM or less.
According to another embodiment, the compounds of the invention have an EC5o for hGLP-1 receptor of 500 pM or less, preferably of 200 pM or less; more preferably of 150 pM or less, more preferably of 100 pM or less, more preferably of 90 pM or less, more preferably of 80 pM or less, more preferably of 70 pM or less, more preferably of 60 pM or less, more preferably of 50 pM or less, more preferably of 40 pM or less, more preferably of 30 pM or less, and more preferably of 20 pM or less, and/or an EC5o for hGIP receptor of 500 pM or less, preferably of 200 pM or less; more preferably of 150 pM or less, more preferably of 100 pM or less, more preferably of 90 pM or less, more preferably of 80 pM or less, more preferably of 70 pM or less, more preferably of 60 pM or less, more preferably of 50 pM or less, more preferably of 40 pM or less, more preferably of 30 pM or less, and more preferably of 20 pM or less, and/or optionally an EC5o for hGlucagon receptor of 500 pM or less, preferably of 200 pM or less; more preferably of 150 pM or less, more preferably of 100 pM or less, more preferably of 90 pM or less, more preferably of 80 pM or less, more preferably of 70 pM or less, more preferably of 60 pM or less, more preferably of 50 pM or less, more preferably of 40 pM or less, more preferably of 30 pM or less, and more preferably of 20 pM or less.
In still another embodiment, the EC50 for both receptors, i.e. for the hGLP-1 receptor and for the hGIP receptor, is 500 pM or less, more preferably 200 pM or less, more preferably 150 pM or less, more preferably 100 pM or less, more preferably 90 pM or less, more preferably 80 pM or less, more preferably 70 pM or less, more preferably 60 pM or less, more preferably 50 pM or less, more preferably 40 pM or less, more preferably 30 pM or less, more preferably 20 pM or less.
In still another embodiment, the EC50 for all three receptors, i.e. for the hGLP-1 receptor, for the hGIP receptor and for the hGlucagon receptor, is 500 pM or less, more preferably 200 pM or less, more preferably 150 pM or less, more preferably 100 pM or less, more preferably 90 pM or less, more preferably 80 pM or less, more preferably 70 pM or less, more preferably 60 pM or less, more preferably 50 pM or less, more preferably 40 pM or less, more preferably 30 pM or less, more preferably 20 pM or less.
The EC5o for hGLP-1 receptor, hGIP receptor and hGlucagon receptor may be determined as described in the Methods herein and as used to generate the results described in Example 5.
The compounds of the invention have the ability to reduce the intestinal passage, to increase the gastric content and/or to reduce the food intake of a patient. These activities of the compounds of the invention can be assessed in animal models known to the skilled person and also described herein in the Methods. Preferred compounds of the invention may increase the gastric content of mice, preferably of female NMRI-mice, if administered as a single dose, preferably subcutaneous dose, of 0.02 mg/kg body weight by at least 25%, more preferably by at least 30%, more preferably by at least 40%, more preferably by at least 50%, more preferably by at least 60%, more preferably by at least 70%, more preferably by at least 80%.
Preferably, this result is measured 1 h after administration of the respective compound and 30 mins after administration of a bolus, and/or reduces intestinal passage of mice, preferably of female NMRI-mice, if administered as a single dose, preferably subcutaneous dose, of 0.02 mg/kg body weight at least by 45%; more preferably by at least 50%, more preferably by at least 55%, more preferably by at least 60%, and more preferably at least 65%; and/or reduces food intake of mice, preferably of female NMRI-mice, over a period of 22 h, if administered as a single dose, preferably subcutaneous dose of 0.01 mg/kg body weight by at least 10%, more preferably 15%, and more preferably 20%.
The compounds of the invention have the ability to reduce blood glucose level, and/or to reduce HbA1 c levels of a patient. These activities of the compounds of the invention can be assessed in animal models known to the skilled person and also described herein in the Methods.
Preferred compounds of the invention may reduce blood glucose level of mice, preferably in female leptin-receptor deficient diabetic db/db mice over a period of 24 h, if administered as a single dose, preferably subcutaneous dose, of 0.01 mg/kg body weight by at least 4 mmol/L; more preferably by at least 6 mmol/L, more preferably by at least 8 mmol/L. If the dose is increased to 0.1 mg/kg body weight a more pronounced reduction of blood glucose levels can be observed in mice over a period of 24 h, if administered as a single dose, preferably subcutaneous dose. Preferably the compounds of the invention lead to a reduction by at least 7 mmol/L; more preferably by at least 9 mmol/L, more preferably by at least 1 1 mmol/L. The compounds of the invention preferably reduce the increase of HbA1 c levels of mice over a period of 4 weeks, if administered at a daily dose of 0.01 mg/kg to about the ignition value.
The compounds of the invention also have the ability to reduce body weight of a patient. These activities of the compounds of the invention can be assessed in animal models known to the skilled person.
Surprisingly, it was found that peptidic compounds of the formula (I), particularly those with a lysine (or close analogues) at position 14 which is further substituted with a lipophilic residue, showed very potent GLP-1 and GIP receptor activation; additionally in combination with amino acids like Gin in position 3 also very potent glucagon receptor activation can be provided . It is described in the literature (Murage EN et al., Bioorg. Med. Chem. 16 (2008), 10106-101 12), that a GLP-1 analogue with an acetylated Lysine at Pos.14 showed significantly reduced potency compared to natural GLP-1 .
Furthermore, oxidation (in vitro or in vivo) of methionine, present in the core structure of exendin-4, is not possible anymore for peptidic compounds of the formula (I).
Further, compounds of the invention preferably have a high solubility at
acidic and/or physiological pH values, e.g., at pH 4.5 and/or at pH 7.4 at 25°C, in another embodiment at least 0.5 mg/ml and in a particular embodiment at least 1 .0 mg/ml.
Furthermore, according to one embodiment, compounds of the invention preferably have a high stability when stored in solution. Preferred assay conditions for determining the stability is storage for 7 days at 25°C in solution at pH 4.5 or pH 7.4. The remaining amount of peptide is determined by chromatographic analyses as described in Methods and Examples. Preferably, after 7 days at 25°C in solution at pH 4.5 or pH 7.4, the remaining peptide amount is at least 80%, more preferably at least 85%, even more preferably at least 90% and even more preferably at least 95%.
Preferably, the compounds of the present invention comprise a peptide moiety Z (formula II) which is a linear sequence of 39-40 amino carboxylic acids, particularly a-amino carboxylic acids linked by peptide, i.e. carboxamide, bonds.
In one embodiment position X14 represents an amino acid residue with a functionalized -NH2 side chain group, such as functionalized Lys, Orn, Dab, or Dap, more preferably functionalized Lys and X40 is absent or represents Lys.
An amino acid residue with an -NH2 side chain group, e.g. Lys, Orn, Dab or Dap, may be functionalized in that at least one H atom of the -NH2 side chain group is replaced by -C(O)-R5, -C(O)O-R5, -C(O)NH-R5, -S(0)2-R5 or R5, preferably by -C(O)-R5, wherein R5 is a moiety comprising up to 50 or up to 100 carbon atoms and optionally heteroatoms selected from halogen, N, O, S and/or P.
In certain embodiments, R5 may comprise a lipophilic moiety, e.g. an acyclic linear or branched saturated hydrocarbon group, wherein R5 particularly comprises an acyclic linear or branched (C4-C3o) saturated or unsaturated hydrocarbon group, and/or a cyclic saturated, unsaturated or aromatic group, particularly a mono-, bi-, or tricyclic group comprising 4 to 14 carbon atoms and 0, 1 , or 2 heteroatoms selected from N, O, and S, e.g. cyclohexyl, phenyl, biphenyl, chromanyl, phenanthrenyl or naphthyl, wherein the acyclic or cyclic group may be unsubstituted or substituted e.g. by halogen, -OH and/or CO2H.
More preferred groups R5 may comprise a lipophilic moiety, e.g. an acyclic linear or branched (C12-C22) saturated or unsaturated hydrocarbon group. The lipophilic moiety may be attached to the -NH2 side chain group by a linker in all stereoisomeric forms, e.g. a linker comprising one or more, e.g. 2, 3 or 4, amino acid linker groups such as γ-aminobutyric acid (GABA), ε-aminohexanoic acid (ε-Ahx), γ-Glu and/or β-Ala. In one embodiment the lipophilic moiety is attached to the -NH2 side chain group by a linker. In another embodiment the lipophilic moiety is directly attached to the -NH2 side chain group. Specific examples of amino acid linker groups are (β-Ala)-!-4, (Y-GI U)I-4, (£-Ahx) -4, or (GABA) -4. Preferred amino acid linker groups are β-Ala, Y-Glu, B-Ala-B-Ala and γ-Glu-Y-Glu.
Specific preferred examples for -C(O)-R5 groups are listed in the following Table 3, which are selected from the group consisting of (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, 4-Hexadecanoylamino-butyryl-, 4-{3-[(R)-2,5,7,8-tetramethyl-2-((4R,8R)-4,8,12-trimethyl-tridecyl)-chroman-6-yloxycarbonyl]-propionylamino}-butyryl-, 4-octadecanoylamino-butyryl-, 4-((Z)-octadec-9-enoylamino)-butyryl-, 6-[(4,4-Diphenyl-cyclohexyloxy)-hydroxy-phosphoryloxy]-hexanoyl-,
Hexadecanoyl-, (S)-4-Carboxy-4-(15-carboxy-pentadecanoylamino)-butyryl-, (S)-4-Carboxy-4-{3-[3-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylamino)-propionylamino]-propionylamino}-butyryl-, (S)-4-Carboxy-4-{3-[(R)-2,5,7,8-tetramethyl-2-((4R,8R)-4,8,12-trimethyl-tridecyl)-chroman-6-yloxycarbonyl]-propionylamino}-butyryl-, (S)-4-Carboxy-4-((9Z,12Z)-
octadeca-9,12-dienoylamino)-butyryl-, (S)-4-Carboxy-4-[6-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylannino)-hexanoylannino]-butyryl-, (S)-4-Carboxy-4-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylamino)-butyryl-, (S)-4-Carboxy-4-tetradecanoylamino-butyryl-, (S)-4-(1 1 -Benzyloxycarbonyl-undecanoylamino)-4-carboxy-butyryl-, (S)-4-Carboxy-4-[1 1 -((2S,3R,4R,5R)-2,3,4,5,6-pentahydroxy-hexylcarbamoyl)-undecanoylamino]-butyryl-, (S)-4-Carboxy-4-((Z)-octadec-9-enoylamino)-butyryl-, (S)-4-Carboxy-4-(4-dodecyloxy-benzoylamino)-butyryl-, (S)-4-Carboxy-4-henicosanoylamino-butyryl-, (S)-4-Carboxy-4-docosanoylamino-butyryl-, (S)-4-Carboxy-4-((Z)-nonadec-10-enoylamino)-butyryl-, (S)-4-Carboxy-4-(4-decyloxy-benzoylamino)-butyryl-, (S)-4-Carboxy-4-[(4'-octyloxy-biphenyl-4-carbonyl)-amino]-butyryl-, (S)-4-Carboxy-4-(12-phenyl-dodecanoylamino)-butyryl-, (S)-4-Carboxy-4-icosanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylannino)-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-octadecanoylamino-butyrylannino)-butyryl-, 3-(3-Octadecanoylamino-propionylannino)-propionyl-, 3-(3-Hexadecanoyl-amino-propionylannino)-propionyl-, 3-Hexadecanoylamino-propionyl-, (S)-4-Carboxy^-KRH-iiSR.SS R.eR.QR.10S,12S,13R,14R,17R)-3,7,12-trihydroxy-8,10,13-trimethyl-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-pentanoylamino]-butyryl-, (S)-4-Carboxy-4-[(R)-4-((3R,5R,8R,9S,1 OS, 13R,14S,17R)-3-hydroxy-10,13-dimethyl-hexadecahydro-cyclopenta-[a]phenanthren-17-yl)-pentanoylamino]-butyryl-, (S)-4-Carboxy-4-((9S,1 OR)-9,10,16-trihydroxy-hexadecanoylamino)-butyryl-, Tetradecanoyl-, 1 1 -Carboxy-undecanoyl-, 1 1 -Benzyloxycarbonyl-undecanoyl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-tetradecanoylamino-butyrylannino)-butyryl-, 6-[Hydroxy-(naphthalene-2-yloxy)-phosphoryloxy]-hexanoyl-, 6-[Hydroxy-(5-phenyl-pentyloxy)-phosphoryloxy]-hexanoyl-, 4-(Naphthalene-2-sulfonylamino)-4-οχο-butyryl-, 4-(Biphenyl-4-sulfonylamino)-4-oxo-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylannino}-butyryl-, (S)-4-Carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-
ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylannino]-butyryl-, (S)-4-Carboxy-2-{(S)-4-carboxy-2-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylamino}-butyryl-, (S)-4-Carboxy-2-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylannino]-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylannino]-butyrylaminoj-butyryl-, (S)-4-Carboxy-4-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylannino]-butyryl-, (S)-4-Carboxy-2-{(S)-4-carboxy-2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylannino]-butyrylaminoj-butyryl-, (S)-4-Carboxy-2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylannino]-butyryl-, 2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(17-carboxy-heptadecanoylamino) -butyrylamino]-ethoxy}-ethoxy)-acetylannino]-ethoxy}-ethoxy)-acetyl-, 2-(2-{2-[(S)-4-Carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetyl, (S)-4-Carboxy-4-((S)-4-carboxy-4-{(S)-4-carboxy-4-[(S)-4-carboxy-4-(19-carboxy-nonadecanoylamino)-butyrylamino]-butyrylamino}-butyrylamino)-butyryl, 2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(16-1 H-tetrazol-5-yl-hexadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl-, 2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(16-carboxy-hexadecanoyl-amino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-butyrylannino}-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-{2-[2-(2-{2-[2-(2-{(S)-4-carboxy-4-[10-(4-carboxy-phenoxy)-decanoylamino]-butyrylamino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylaminoj-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(7-carboxy-heptanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylannino]-butyrylannino}-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(1 1 -carboxy-undecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylannino]-ethoxy}-
ethoxy)-acetylamino]-butyrylannino}-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy- 4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(13-carboxy-tridecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylaminoj-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2- [(S)-4-carboxy-4-(15-carboxy-pentadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylamino}-butyryl-, and (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(19-carboxy-nonadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylannino]-ethoxy}-ethoxy)-acetylamino]-butyrylannino}-butyryl-.
Further preferred are stereoisomers, particularly enantiomers of these groups, either S- or R-enantiomers. The term "R" in Table 3 is intended to mean the attachment site of -C(O)-R5 at the peptide back bone, i.e. particularly the ε-amino group of Lys.
ĭ33
ln some embodiments, the invention relates to peptidic compounds of Formula (I) as defined above, wherein X14 represents an amino acid residue selected from Lys, Orn, Dab and Dap, wherein the -NH2 side chain group is functionalized by -C(O)-R5, X40 represents an amino acid residue selected from Lys, Orn, Dab and Dap, wherein the -NH2 side chain group can be functionalized by -C(O)-R5, and R5 is a lipophilic moiety selected from an acyclic linear or branched (C4-C3o) saturated or unsaturated hydrocarbon group, and/or a cyclic saturated, unsaturated or aromatic group, wherein the lipophilic moiety may be attached to the -NH2 side chain group by a linker selected from ( -Ala)i-4, (Y-GI U)I-4, (£-Ahx)1-4, or (GABA)1-4 in all stereoisomeric forms.
In certain embodiments, X14 represents an amino acid residue with a functionalized -NH2 side chain group, such as functionalized Lys, Orn, Dab or Dap, wherein at least one H atom of the -NH2 side chain group is replaced by -C(O)-R5, which is selected from the group consisting of the substituents according to Table 3 above.
In some embodiments, X14 represents an amino acid residue selected from Lys, Orn, Dab and Dap, wherein the -NH2 side chain group is functionalized by -C(O)-R5, X40 represents an amino acid residue selected from Lys, Orn, Dab and Dap, wherein the -NH2 side chain group can be functionalized by -C(O)-R5, and -C(O)-R5 is selected from the group consisting of the substituents according to Table 3 above.
In some embodiments of the invention, position X14 and/or X40 in formula (II) represents Lysine (Lys). According to some embodiments, Lys at position 14 and optionally at position 40 is functionalized, e.g. with a group -C(O)R5 as described above. In other embodiments, X40 is absent and X14 is Lys functionalized with -C(O)-R5, -C(O)O-R5, -C(O)NH-R5, -S(O)2-R5 or R5, preferably by -C(O)-R5, wherein R5 is as defined above. In particular, X14 is Lys functionalized with C(O)-R5, wherein R5 is selected from the group
consisting of (S)-4-carboxy-4-hexadecanoylamino-butyryl (γΕ-χ53), (S)-4-carboxy-4-octadecanoylamino-butyryl (γΕ-χ70), 4-hexadecanoylamino-butyryl (GABA-x53), 4-{3-[(Ρ)-2,5,7,8-ίθίΓ3ηηθίήγΙ-2-((4Ρ,8Ρ)-4,8,12-trimethyl-tridecyl)-chroman-6-yloxycarbonyl]-propionylamino}-butyryl-(GABA-x60), 4-octadecanoylamino-butyryl (GABA-x70), 4-((Z)-octadec-9-enoylamino)-butyryl (GABA-x74), 6-[(4,4-Diphenyl-cyclohexyloxy)-hydroxy-phosphoryloxy]-hexanoyl (Phosphol ), Hexadecanoyl (x53), (S)-4-Carboxy-4-(15-carboxy-pentadecanoylamino)-butyryl (x52), (S)-4-Carboxy-4-{3-[3-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylannino)-propionylamino]-propionylannino}-butyryl (γΕ-χ59), (S)-4-Carboxy-4-{3-[(R)-2,5,7,8-tetramethyl-2-((4R,8R)-4,8,12-trimethyl-tndecyl)-chroman-6-yloxycarbonyl]-propionylamino}-butyryl (γΕ-χ60), (S)-4-Carboxy-4-((9Z,12Z)-octadeca-9,12-dienoylamino)-butyryl (γΕ-χ61 ), (S)-4-Carboxy-4-[6-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylannino)-hexanoylamino]-butyryl (γΕ-χ64), (S)-4-Carboxy-4-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylannino)-butyryl (γΕ-χ65), (S)-4-carboxy-4-tetradecanoylamino-butyryl (γΕ-χ69), (S)-4-(1 1 - Benzyloxycarbonyl-undecanoylamino)-4-carboxy-butyryl (γΕ-χ72), (S)-4-carboxy-4-[1 1 -((2S,3R,4R,5R)-2,3,4,5,6-pentahydroxy-hexylcarbamoyl)-undecanoylamino]-butyryl (γΕ-χ73), (S)-4-Carboxy-4-((Z)-octadec-9-enoylamino)-butyryl (γΕ-χ74), (S)-4-Carboxy-4-(4-dodecyloxy-benzoylamino)-butyryl (γΕ-χ75), (S)-4-Carboxy-4-henicosanoylamino-butyryl (γΕ-χ76), (S)-4-Carboxy-4-docosanoylamino-butyryl (γΕ-χ77), (S)-4-Carboxy-4-((Z)-nonadec-10-enoylamino)-butyryl (γΕ-χ79), (S)-4-Carboxy-4-(4-decyloxy-benzoylamino)-butyryl (γΕ-χ80), (S)-4-Carboxy-4-[(4'-octyloxy-biphenyl-4-carbonyl)-amino]-butyryl (γΕ-χ81 ), (S)-4-Carboxy-4-(12-phenyl-dodecanoylamino)-butyryl (γΕ-χ82), (S)-4-Carboxy-4-icosanoylamino-butyryl (γΕ-χ95), (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylamino)-butyryl (γΕ-γΕ-χ53), (S)-4-Carboxy-4-((S)-4-carboxy-4-octadecanoylamino-butyrylannino)-butyryl (γΕ-γΕ-χ70), and 3-(3-Octadecanoylamino-propionylannino)-propionyl ( -Ala- -Ala-x70).
ln some embodiments, X14 is Lys functionalized with C(O)-R5, wherein R5 is selected from the group consisting of (S)-4-carboxy-4-hexadecanoylamino-butyryl (γΕ-χ53), (S)-4-carboxy-4-octadecanoylamino-butyryl (γΕ-χ70), and Hexadecanoyl (x53).
A further embodiment relates to a group of compounds, wherein
R1 is NH2,
R2 is NH2 or
R1 and R2 are NH2.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, Glu and His, X12 represents an amino acid residue selected from lie and Lys, X14 represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is functionalized by - C(O)- R5, wherein R5 is as described above,
X15 represents an amino acid residue selected from Asp and Glu, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Lys, Glu, lie, Gin, Leu, Aib, Tyr and Ala,
X18 represents an amino acid residue selected from Ala, Arg, Aib, Leu, Lys and Tyr,
X19 represents an amino acid residue selected from Ala, Gin, Val and Aib,
X20 represents an amino acid residue selected from Gin, Aib, Phe, Arg, Leu, Lys and His,
X21 represents an amino acid residue selected from Asp, Glu, Tyr, and Leu,
X28 represents an amino acid residue selected from Asn, Ala, Aib , Arg and Lys,
X29 represents an amino acid residue selected from Gly, Thr, Aib, D- Ala and Ala,
X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, Glu and His, X12 represents an amino acid residue selected from lie and Lys, X14 represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is functionalized by - C(O)- R5, wherein R5 is as described above,
X15 represents an amino acid residue selected from Asp and Glu, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Lys, Glu, Gin, Leu, Aib, Tyr and Ala,
X18 represents an amino acid residue selected from Ala, Arg, Aib, Leu and Tyr,
X19 represents an amino acid residue selected from Ala, Val and Aib,
X20 represents an amino acid residue selected from Gin, Aib, Phe,
Leu, Lys, His, Pip, (S)MeLys, (R)MeLys and (S)MeOrn,
X21 represents an amino acid residue selected from Asp, Glu and Leu,
X28 represents an amino acid residue selected from Asn, Ala, Aib and
Ser,
X29 represents an amino acid residue selected from Gly, Thr, Aib, D- Ala and Ala,
X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, Glu and His, X12 represents lie,
X14 represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is functionalized by - C(O)- R5, wherein R5 is as described above,
X15 represents an amino acid residue selected from Asp and Glu, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Lys, Glu, Gin, Leu, Aib, Tyr and Ala,
X18 represents an amino acid residue selected from Ala and Arg, X19 represents an amino acid residue selected from Ala and Val, X20 represents an amino acid residue selected from Gin, Aib, Lys, Pip, (S)MeLys, (R)MeLys and (S)MeOrn and His,
X21 represents an amino acid residue selected from Asp, Glu and Leu, X28 represents an amino acid residue selected from Asn and Ala, X29 represents an amino acid residue selected from Gly, Thr and D- Ala,
X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, Glu and His, X12 represents an amino acid residue selected from lie and Lys, X14 represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is functionalized by - C(O)- R5, wherein R5 is as described above,
X15 represents an amino acid residue selected from Asp and Glu, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Lys, Glu, Gin, Leu, Aib, Tyr and Ala,
X18 represents an amino acid residue selected from Ala and Arg, X19 represents an amino acid residue selected from Ala and Val,
X20 represents an amino acid residue selected from Gin, Aib, Lys and His,
X21 represents an amino acid residue selected from Asp, Glu and Leu, X28 represents an amino acid residue selected from Asn and Ala, X29 represents an amino acid residue selected from Gly, Thr and D- Ala,
X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin and Glu, X12 represents lie,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino- butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-octadecanoylamino- butyrylamino)-butyryl-, 3-(3-Octadecanoylamino-propionylamino)- propionyl- and 4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4- henicosanoylamino-butyryl-,
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser and Lys, X17 represents Arg,
X18 represents Ala,
X19 represents Ala,
X20 represents an amino acid residue selected from Gin and Aib, X21 represents an amino acid residue selected from Asp and Glu, X28 represents an amino acid residue selected from Asn and Ala, X29 represents an amino acid residue selected from Gly and Thr, X40 is absent.
A further embodiment relates to a group of compounds, wherein
X3 represents Glu,
X12 represents lie,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino- butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-octadecanoylamino- butyrylamino)-butyryl-, 3-(3-Octadecanoylamino-propionylamino)- propionyl- and 4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4- henicosanoylamino-butyryl-,
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser and Lys, X17 represents Arg,
X18 represents Ala,
X19 represents Ala,
X20 represents an amino acid residue selected from Gin and Aib, X21 represents an amino acid residue selected from Asp and Glu, X28 represents an amino acid residue selected from Asn and Ala, X29 represents an amino acid residue selected from Gly and Thr, X40 is absent.
A further embodiment relates to a group of compounds, wherein
X3 represents Gin,
X12 represents lie,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino- butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-octadecanoylamino- butyrylamino)-butyryl-, 3-(3-Octadecanoylamino-propionylamino)- propionyl- and 4-octadecanoylamino-butyryl-, (S)-4-Carboxy-4- henicosanoylamino-butyryl-,
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser and Lys,
X17 represents Arg,
X18 represents Ala,
X19 represents Ala,
X20 represents an amino acid residue selected from Gin and Aib, X21 represents an amino acid residue selected from Asp and Glu, X28 represents an amino acid residue selected from Asn and Ala, X29 represents an amino acid residue selected from Gly and Thr, X40 is absent.
A further embodiment relates to a group of compounds, wherein
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino- butyryl-, 4-octadecanoylamino-butyryl-, Hexadecanoyl-, (S)-4-Carboxy- 4-henicosanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4- octadecanoylamino-butyrylamino)-butyryl-, 3-(3-Octadecanoylamino- propionylamino)-propionyl-.
A further embodiment relates to a group of compounds, wherein
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- octadecanoylamino-butyryl-, 4-octadecanoylamino-butyryl-, (S)-4- Carboxy-4-henicosanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4- carboxy-4-octadecanoylamino-butyrylamino)-butyryl-, 3-(3- Octadecanoylamino-propionylamino)-propionyl-.
A further embodiment relates to a group of compounds, wherein
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino- butyryl-.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin and Glu,
X12 represents lie,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl- and (S)-4-Carboxy-4-octadecanoylamino- butyryl-,
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser and Lys, X17 represents Arg,
X18 represents Ala,
X19 represents Ala,
X20 represents an amino acid residue selected from Gin and Aib, X21 represents an amino acid residue selected from Asp and Glu, X28 represents an amino acid residue selected from Asn and Ala, X29 represents an amino acid residue selected from Gly and Thr, X40 is absent.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents lie,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl- and (S)-4-Carboxy-4-octadecanoylamino- butyryl-,
X15 represents Glu,
X16 represents an amino acid residue selected from Glu and Lys,
X17 represents Glu,
X18 represents Ala,
X19 represents Val,
X20 represents Arg,
X21 represents Leu,
X28 represents an amino acid residue selected from Asn, Aib and Ala,
X29 represents an amino acid residue selected from Gly and Thr, X40 is absent.
A further embodiment relates to a group of compounds, wherein
X3 represents Glu,
X12 represents lie,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl- and (S)-4-Carboxy-4-octadecanoylamino- butyryl-,
X15 represents Glu,
X16 represents an amino acid residue selected from Glu and Lys,
X17 represents Glu,
X18 represents Ala,
X19 represents Val,
X20 represents Arg,
X21 represents Leu,
X28 represents an amino acid residue selected from Asn, Aib and Ala, X29 represents Gly,
X40 is absent.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents an amino acid residue selected from lie and Lys, X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl- and (S)-4-Carboxy-4-octadecanoylamino- butyryl-,
X15 represents an amino acid residue selected from Glu and Asp, X16 represents Glu,
X17 represents an amino acid residue selected from Arg and Gin,
X18 represents an amino acid residue selected from Ala and Arg, X19 represents Ala,
X20 represents an amino acid residue selected from Pip, (S)MeLys, (R)MeLys and (S)MeOrn,
X21 represents Glu,
X28 represents an amino acid residue selected from Asn, Ser and Ala, X29 represents an amino acid residue selected from Gly and Thr,
X40 is absent.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents an amino acid residue selected from lie and Lys, X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl-, hexadecanoyl- and (S)-4-Carboxy-4- octadecanoylamino-butyryl-,
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Leu, Aib, Tyr, Glu, Ala and Lys,
X18 represents an amino acid residue selected from Ala, Aib, Leu and Tyr,
X19 represents an amino acid residue selected from Ala, Val and Aib, X20 represents Aib,
X21 represents an amino acid residue selected from Glu, Leu and Tyr, X28 represents an amino acid residue selected from Asn, Arg and Ala, X29 represents an amino acid residue selected from Gly, Ala, D-Ala and Thr,
X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4- hexadecanoylamino-butyryl- and (S)-4-Carboxy-4-octadecanoylamino- butyryl-,
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser, Lys and Glu, X17 represents an amino acid residue selected from Arg, Lys, lie, Glu and Gin,
X18 represents an amino acid residue selected from Ala, Arg and Lys, X19 represents an amino acid residue selected from Ala, Val and Gin, X20 represents an amino acid residue selected from Gin, Phe, Leu, Lys, His and Arg,
X21 represents an amino acid residue selected from Glu, Asp and Leu, X28 represents an amino acid residue selected from Asn, Arg, Lys and Ala,
X29 represents an amino acid residue selected from Gly, Aib and Thr, X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X12 represents lie.
A further embodiment relates to a group of compounds, wherein
X19 represents Ala.
A further embodiment relates to a group of compounds, wherein
X16 represents Glu,
X20 represents an amino acid residue selected from Pip, (S)MeLys, (R)MeLys and (S)MeOrn.
A further embodiment relates to a group of compounds, wherein
X28 represents Ala,
X29 represents Gly.
A further embodiment relates to a group of compounds, wherein
X28 represents Asn,
X29 represents Thr.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents an amino acid residue selected from lie and Lys, X14 represents Lys, wherein the -NH2 side chain group is functional ized by - C(O)-R5, wherein R5 is selected from (S)-4-Carboxy- 4-hexadecanoylamino-butyryl- (γΕ-χ53), (S)-4-Carboxy-4- octadecanoylamino-butyryl- (γΕ-χ70) and Hexadecanoyl- (x53),
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin,
X17 represents an amino acid residue selected from Arg, Leu, Aib, Tyr, Glu, Ala, Lys, lie and Gin
X18 represents an amino acid residue selected from Ala, Aib, Leu, Tyr, Arg and Lys
X19 represents an amino acid residue selected from Ala, Val, Aib, and Gin,
X20 represents an amino acid residue selected from Aib, Gin, Phe, Leu, Lys, His and Arg,
X21 represents an amino acid residue selected from Glu, Leu, Tyr and Asp,
X28 represents an amino acid residue selected from Asn, Arg, Ala and Lys,
X29 represents an amino acid residue selected from Gly, Ala, D-Ala, Thr and Aib,
X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents an amino acid residue selected from lie and Lys, X14 represents Lys, wherein the -NH2 side chain group is functional ized by - C(O)-R5, wherein R5 is selected from (S)-4-Carboxy- 4-hexadecanoylamino-butyryl- (γΕ-χ53), (S)-4-Carboxy-4- octadecanoylamino-butyryl- (γΕ-χ70) and Hexadecanoyl- (x53),
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser, Lys and Gin, X17 represents an amino acid residue selected from Arg, Leu, Aib, Tyr, Glu, Ala and Lys,
X18 represents an amino acid residue selected from Ala, Aib, Leu and Tyr,
X19 represents an amino acid residue selected from Ala, Val and Aib, X20 represents Aib,
X21 represents an amino acid residue selected from Glu, Leu and Tyr,
X28 represents an amino acid residue selected from Asn, Arg and Ala, X29 represents an amino acid residue selected from Gly, Ala, D-Ala and Thr,
X40 is either absent or represents Lys.
A further embodiment relates to a group of compounds, wherein
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents an amino acid residue selected from lie and Lys, X14 represents Lys, wherein the -NH2 side chain group is functional ized by - C(O)-R5, wherein R5 is selected from (S)-4-Carboxy- 4-hexadecanoylamino-butyryl- (γΕ-χ53) and (S)-4-Carboxy-4- octadecanoylamino-butyryl- (γΕ-χ70),
X15 represents an amino acid residue selected from Glu and Asp, X16 represents an amino acid residue selected from Ser, Lys, Glu, X17 represents an amino acid residue selected from Arg, Glu, Lys, lie and Gin
X18 represents an amino acid residue selected from Ala, Arg and Lys X19 represents an amino acid residue selected from Ala, Val and Gin, X20 represents an amino acid residue selected from Gin, Phe, Leu, Lys, His and Arg,
X21 represents an amino acid residue selected from Glu, Leu and Asp, X28 represents an amino acid residue selected from Asn, Arg, Ala and
Lys,
X29 represents an amino acid residue selected from Gly, Thr and Aib, X40 is either absent or represents Lys.
Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 8-66 as well as salts and solvates thereof.
Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 8-27, 29-61 and 66 as well as salts and solvates thereof.
Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 8-29 as well as salts and solvates thereof.
Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 8-27 and 29 as well as salts and solvates thereof.
Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 30-66 as well as salts and solvates thereof.
Specific examples of peptidic compounds of formula (I) are the compounds of SEQ ID NO: 30-61 and 66 as well as salts and solvates thereof.
In certain embodiments, i.e. when the compound of formula (I) comprises genetically encoded amino acid residues, the invention further provides a nucleic acid (which may be DNA or RNA) encoding said compound, an expression vector comprising such a nucleic acid, and a host cell containing such a nucleic acid or expression vector.
ln a further aspect, the present invention provides a composition comprising a compound of the invention in admixture with a carrier. In preferred embodiments, the composition is a pharmaceutically acceptable composition and the carrier is a pharmaceutically acceptable carrier. The compound of the invention may be in the form of a salt, e.g. a pharmaceutically acceptable salt or a solvate, e.g. a hydrate. In still a further aspect, the present invention provides a composition for use in a method of medical treatment, particularly in human medicine.
In certain embodiments, the nucleic acid or the expression vector may be used as therapeutic agents, e.g. in gene therapy.
The compounds of formula (I) are suitable for therapeutic application without an additionally therapeutically effective agent. In other embodiments, however, the compounds are used together with at least one additional therapeutically active agent, as described in "combination therapy".
The compounds of formula (I) are particularly suitable for the treatment or prevention of diseases or disorders caused by, associated with and/or accompanied by disturbances in carbohydrate and/or lipid metabolism, e.g. for the treatment or prevention of hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, obesity and metabolic syndrome.
Further, the compounds of the invention are particularly suitable for the treatment or prevention of degenerative diseases, particularly neurodegenerative diseases.
The compounds described find use, inter alia, in preventing weight gain or promoting weight loss. By "preventing" is meant inhibiting or reducing when compared to the absence of treatment, and is not necessarily meant to imply complete cessation of a disorder.
The compounds of the invention may cause a decrease in food intake and/or increase in energy expenditure, resulting in the observed effect on body weight.
Independently of their effect on body weight, the compounds of the invention may have a beneficial effect on circulating cholesterol levels, being capable of improving lipid levels, particularly LDL, as well as HDL levels (e.g. increasing HDL/LDL ratio).
Thus, the compounds of the invention can be used for direct or indirect therapy of any condition caused or characterised by excess body weight, such as the treatment and/or prevention of obesity, morbid obesity, obesity linked inflammation, obesity linked gallbladder disease, obesity induced sleep apnea. They may also be used for treatment and prevention of the metabolic syndrome, diabetes, hypertension, atherogenic dyslipidemia, atherosclerosis, arteriosclerosis, coronary heart disease, or stroke. Their effects in these conditions may be as a result of or associated with their effect on body weight, or may be independent thereof.
Preferred medical uses include delaying or preventing disease progression in type 2 diabetes, treating metabolic syndrome, treating obesity or preventing overweight, for decreasing food intake, increase energy expenditure, reducing body weight, delaying the progression from impaired glucose tolerance (IGT) to type 2 diabetes; delaying the progression from type 2 diabetes to insulin-requiring diabetes; regulating appetite; inducing satiety; preventing weight regain after successful weight loss; treating a disease or state related to overweight or obesity; treating bulimia; treating binge eating; treating atherosclerosis, hypertension, type 2 diabetes, IGT, dyslipidemia, coronary heart disease, hepatic steatosis, treatment of beta-blocker poisoning, use for inhibition of the motility of the gastrointestinal tract, useful in connection with investigations of the gastrointestinal tract using techniques such as X-ray, CT- and NMR-scanning.
Further preferred medical uses include treatment or prevention of degenerative disorders, particularly neurodegenerative disorders such as Alzheimer's disease, Parkinson's disease, Huntington's disease, ataxia, e.g spinocerebellar ataxia, Kennedy disease, myotonic dystrophy, Lewy body dementia, multi-systemic atrophy, amyotrophic lateral sclerosis, primary lateral sclerosis, spinal muscular atrophy, prion-associated diseases, e.g. Creutzfeldt-Jacob disease, multiple sclerosis, telangiectasia, Batten disease, corticobasal degeneration, subacute combined degeneration of spinal cord, Tabes dorsalis, Tay-Sachs disease, toxic encephalopathy, infantile Refsum disease, Refsum disease, neuroacanthocytosis, Niemann-Pick disease, Lyme disease, Machado-Joseph disease, Sandhoff disease, Shy-Drager syndrome, wobbly hedgehog syndrome, proteopathy, cerebral β-amyloid angiopathy, retinal ganglion cell degeneration in glaucoma, synucleinopathies, tauopathies, frontotemporal lobar degeneration (FTLD), dementia, cadasil syndrome, hereditary cerebral hemorrhage with amyloidosis, Alexander disease, seipinopathies, familial amyloidotic neuropathy, senile systemic amyloidosis, serpinopathies, AL (light chain) amyloidosis (primary systemic amyloidosis), AH (heavy chain) amyloidosis, AA (secondary) amyloidosis, aortic medial amyloidosis, ApoAI amyloidosis, ApoAII amyloidosis, ApoAIV amyloidosis, familial amyloidosis of the Finnish type (FAF), Lysozyme amyloidosis, Fibrinogen amyloidosis, Dialysis amyloidosis, Inclusion body myositis/myopathy, Cataracts, Retinitis pigmentosa with rhodopsin mutations, medullary thyroid carcinoma, cardiac atrial amyloidosis, pituitary prolactinoma, Hereditary lattice corneal dystrophy, Cutaneous lichen amyloidosis, Mallory bodies, corneal lactoferrin amyloidosis, pulmonary alveolar proteinosis, odontogenic (Pindborg) tumor amyloid, cystic fibrosis, sickle cell disease or critical illness myopathy (CIM).
Further medical uses include treatment of bone related disorders, such as osteoporosis or osteoarthritis, etc., where increased bone formation and decreased bone resorption might be beneficial.
DETAILED DESCRIPTION OF THE INVENTION
Definitions
The amino acid sequences of the present invention contain the conventional one letter and three letter codes for naturally occuring amino acids, as well as generally accepted three letter codes for other amino acids, such as Aib (a-aminoisobutyric acid), Orn (ornithin), Dab (2,4-diamino butyric acid), Dap (2,3-diamino propionic acid), NIe (norleucine), GABA (γ-aminobutyric acid) or Ahx (ε-aminohexanoic acid).
Furthermore, the following codes were used for the amino acids shown in Table 4:
Table 4:
structure name code
N H.,
(S)MeLys (S)-a-met yl-lysine (S)MeLys
H .N o
N H
(R)MeLys (R)-a-met yl-lysine (R)MeLys
□
(S)MeOrn (S)-a-met yl-ornithin (S) eOrn
NH,
Pip 4-amino-piperidine-4-carboxylic acid Pip
The term„native exendin-4" refers to native exendin-4 having the sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 (SEQ ID NO: 1 ).
The invention provides peptidic compounds as defined above.
The peptidic compounds of the present invention comprise a linear backbone of amino carboxylic acids linked by peptide, i.e. carboxamide bonds. Preferably, the amino carboxylic acids are a-amino carboxylic acids and more preferably L-a-amino carboxylic acids, unless indicated otherwise. The peptidic compounds preferably comprise a backbone sequence of 39-40 amino carboxylic acids.
The peptidic compounds of the present invention may have unmodified side-chains, but carry at least one modification at one of the side chains.
For the avoidance of doubt, in the definitions provided herein, it is generally intended that the sequence of the peptidic moiety (II) differs from native exendin-4 at least at one of those positions which are stated to allow variation. Amino acids within the peptide moiety (II) can be considered to be numbered consecutively from 0 to 40 in the conventional N-terminal to C-terminal direction. Reference to a ..position" within peptidic moiety (II) should be constructed accordingly, as should reference to positions within native exendin-4 and other molecules, e.g., in exendin-4, His is at position 1 , Gly at position 2, Met at position 14, ... and Ser at position 39.
The amino acid residues at position 14 and optionally at position 40, having a side chain with an - NH2 group, e.g. Lys, Orn, Dab or Dap are conjugated to a functional group, e.g. acyl groups. Thus, one or more selected amino acids of the peptides in the present invention may carry a covalent attachment at their side chains. In some cases those attachments may be lipophilic. These lipophilic side chain attachments have the potential to reduce in vivo clearance of the peptides thus increasing their in vivo half-lives.
The lipophilic attachment may consist of a lipophilic moiety which can be a branched or unbranched, aliphatic or unsaturated acyclic moiety and/or a cyclic moiety selected from one or several aliphatic or unsaturated homocycles or heterocycles, aromatic condensed or non-condensed homocycles or heterocycles, ether linkages, unsaturated bonds and substituents, e.g. hydroxy and/or carboxy groups. The lipophilic moiety may be attached to the peptide either by alkylation, reductive amination or by an amide bond, a carbamate or a sulfonamide bond in case of amino acids carrying an amino group at their side chain.
Nonlimiting examples of lipophilic moieties that can be attached to amino acid side chains include fatty acids, e.g. C8-3o fatty acids such as palmitic acid, myristic acid, stearic acid and oleic acid, and/or cyclic groups as described above or derivatives thereof.
There might be one or several linkers between the amino acid of the peptide and the lipophilic attachment. Nonlimiting examples of those linkers are β-alanine, γ-glutamic acid, a-glutamic acid, γ-aminobutyric acid and/or ε-aminohexanoic acid or dipeptides, such as -Ala- -Ala (also abbreviated A-βΑ herein) and/or γ-Glu-y-Glu (also abbreviated γΕ-γΕ herein) in all their stereo-isomer forms (S and R enantiomers).
Thus, one nonlimiting example of a side chain attachment is palmitic acid which is covalently linked to the a-amino group of glutamic acid forming an amide bond. The γ-carboxy group of this substituted glutamic acid can form an amide bond with the side chain amino group of a lysine within the peptide.
In a further aspect, the present invention provides a composition comprising a compound of the invention as described herein, or a salt or solvate thereof, in admixture with a carrier.
The invention also provides the use of a compound of the present invention for use as a medicament, particularly for the treatment of a condition as described below.
The invention also provides a composition wherein the composition is a pharmaceutically acceptable composition, and the carrier is a pharmaceutically acceptable carrier.
Peptide synthesis
The skilled person is aware of a variety of different methods to prepare the peptides that are described in this invention. These methods include but are not limited to synthetic approaches and recombinant gene expression. Thus, one way of preparing these peptides is the synthesis in solution or on a solid support and subsequent isolation and purification. A different way of preparing the peptides is gene expression in a host cell in which a DNA sequence encoding the peptide has been introduced. Alternatively, the gene expression can be achieved without utilizing a cell system. The methods described above may also be combined in any way.
A preferred way to prepare the peptides of the present invention is solid phase synthesis on a suitable resin. Solid phase peptide synthesis is a well established methodology (see for example: Stewart and Young, Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, III., 1984; E. Atherton and R. C. Sheppard, Solid Phase Peptide Synthesis. A Practical Approach, Oxford-IRL Press, New York, 1989). Solid phase synthesis is initiated by attaching an N-terminally protected amino acid with its carboxy terminus to an inert solid support carrying a cleavable linker. This solid support can be any polymer that allows coupling of the initial amino acid, e.g. a trityl resin, a chlorotrityl resin, a Wang resin or a Rink resin in which the linkage of the carboxy group (or carboxamide for Rink resin) to the resin is sensitive to acid (when Fmoc strategy is used). The polymer support must be stable under the conditions used to deprotect the a-amino group during the peptide synthesis.
After the first amino acid has been coupled to the solid support, the a-amino protecting group of this amino acid is removed. The remaining protected amino acids are then coupled one after the other in the order represented by the peptide sequence using appropriate amide coupling reagents, for example BOP, HBTU, HATU or DIC (Ν,Ν'-diisopropylcarbodiimide) / HOBt (1 -hydroxybenzotriazol), wherein BOP, HBTU and HATU are used with
tertiary amine bases. Alternatively, the liberated N-terminus can be functionalized with groups other than amino acids, for example carboxylic acids, etc.
Usually, reactive side-chain groups of the amino acids are protected with suitable blocking groups. These protecting groups are removed after the desired peptides have been assembled. They are removed concomitantly with the cleavage of the desired product from the resin under the same conditions. Protecting groups and the procedures to introduce protecting groups can be found in Protective Groups in Organic Synthesis, 3d ed., Greene, T. W. and Wuts, P. G. M., Wiley & Sons (New York: 1999).
In some cases it might be desirable to have side-chain protecting groups that can selectively be removed while other side-chain protecting groups remain intact. In this case the liberated functionality can be selectively functionalized. For example, a lysine may be protected with an ivDde ([1 -(4,4-dimethyl-2,6-dioxocyclohex-1 -ylidene)-3-methylbutyl) protecting group (S.R. Chhabra et al., Tetrahedron Lett. 39, (1998), 1603) which is labile to a very nucleophilic base, for example 4% hydrazine in DMF (dimethyl formamide). Thus, if the N-terminal amino group and all side-chain functionalities are protected with acid labile protecting groups, the ivDde group can be selectively removed using 4% hydrazine in DMF and the corresponding free amino group can then be further modified, e.g. by acylation. The lysine can alternatively be coupled to a protected amino acid and the amino group of this amino acid can then be deprotected resulting in another free amino group which can be acylated or attached to further amino acids.
Finally the peptide is cleaved from the resin. This can be achieved by using King's cocktail (D. S. King, C. G. Fields, G. B. Fields, Int. J. Peptide Protein Res. 36, 1990, 255-266). The raw material can then be purified by chromatography, e.g. preparative RP-HPLC, if necessary.
Potency
As used herein, the term "potency" or "in vitro potency" is a measure for the ability of a compound to activate the receptors for GLP-1 , GIP or glucagon in a cell-based assay. Numerically, it is expressed as the "EC50 value", which is the effective concentration of a compound that induces a half maximal increase of response (e.g. formation of intracellular cAMP) in a dose-response experiment.
Therapeutic uses
The compounds of the invention are agonists for the receptors for GLP-1 and for GIP as well as optionally the glucagon receptor (e.g. "dual or trigonal agonists"). Such peptides that are GIP/GLP-1 co-agonists, or GIP/GLP-1/glucagon tri-agonists may provide therapeutic benefit to address a clinical need for targeting the metabolic syndrome by allowing simultaneous treatment of diabetes and obesity.
Metabolic syndrome is a combination of medical disorders that, when occurring together, increase the risk of developing type 2 diabetes, as well as atherosclerotic vascular disease, e.g. heart disease and stroke. Defining medical parameters for the metabolic syndrome include diabetes mellitus, impaired glucose tolerance, raised fasting glucose, insulin resistance, urinary albumin secretion, central obesity, hypertension, elevated triglycerides, elevated LDL cholesterol and reduced HDL cholesterol.
Obesity is a medical condition in which excess body fat has accumulated to the extent that it may have an adverse effect on health and life expectancy and due to its increasing prevalence in adults and children it has become one of the leading preventable causes of death in modern world. It increases the likelihood of various other diseases, including heart disease, type 2 diabetes, obstructive sleep apnea, certain types of cancer, as well as osteoarthritis, and it is most commonly caused by a combination of excess food intake, reduced energy expenditure, as well as genetic susceptibility.
Diabetes mellitus, often simply called diabetes, is a group of metabolic diseases in which a person has high blood sugar levels, either because the body does not produce enough insulin, or because cells do not respond to the insulin that is produced. The most common types of diabetes are: (1 ) type 1 diabetes, where the body fails to produce insulin; (2) type 2 diabetes, where the body fails to use insulin properly, combined with an increase in insulin deficiency over time, and (3) gestational diabetes, where women develop diabetes due to their pregnancy. All forms of diabetes increase the risk of long-term complications, which typically develop after many years. Most of these long-term complications are based on damage to blood vessels and can be divided into the two categories "macrovascular" disease, arising from atherosclerosis of larger blood vessels and "microvascular" disease, arising from damage of small blood vessels. Examples for macrovascular disease conditions are ischemic heart disease, myocardial infarction, stroke and peripheral vascular disease. Examples for microvascular diseases are diabetic retinopathy, diabetic nephropathy, as well as diabetic neuropathy.
The receptors for GLP-1 and GIP as well as glucagon are members of the family of 7-transmembrane-spanning, heterotrimeric G-protein coupled receptors. They are structurally related to each other and share not only a significant level of sequence identity, but have also similar mechanisms of ligand recognition and intracellular signaling pathways.
Similarly, the peptides GLP-1 , GIP and glucagon share regions of high sequence identity/similarity. GLP-1 and glucagon are produced from a common precursor, preproglucagon, which is differentially processed in a tissue-specific manner to yield e.g. GLP-1 in intestinal endocrine cells and glucagon in alpha cells of pancreatic islets. GIP is derived from a larger proGIP prohormone precursor and is synthesized and released from K-cells located in the small intestine.
The peptidic incretin hormones GLP-1 and GIP are secreted by intestinal endocrine cells in response to food and account for up to 70% of meal-stimulated insulin secretion. Evidence suggests that GLP-1 secretion is reduced in subjects with impaired glucose tolerance or type 2 diabetes, whereas responsiveness to GLP-1 is still preserved in these patients. Thus, targeting of the GLP-1 receptor with suitable agonists offers an attractive approach for treatment of metabolic disorders, including diabetes. The receptor for GLP-1 is distributed widely, being found mainly in pancreatic islets, brain, heart, kidney and the gastrointestinal tract. In the pancreas, GLP-1 acts in a strictly glucose-dependent manner by increasing secretion of insulin from beta cells. This glucose-dependency shows that activation of GLP-1 receptors is unlikely to cause hypoglycemia. Also the receptor for GIP is broadly expressed in peripheral tissues including pancreatic islets, adipose tissue, stomach, small intestine, heart, bone, lung, kidney, testis, adrenal cortex, pituitary, endothelial cells, trachea, spleen, thymus, thyroid and brain. Consistent with its biological function as incretin hormone, the pancreatic β-cell express the highest levels of the receptor for GIP in humans. There is some clinical evidence that the GIP-receptor mediated signaling could be impaired in patients with T2DM but GIP-action is shown to be reversible and could be restored with improvement of the diabetic status. Of note, the stimulation of insulin secretion by both incretin hormones, GIP and GLP-1 is strictly glucosed-dependent ensuring a fail-safe mechanism associated with at low risk for hypoglycemia.
At the beta cell level, GLP-1 and GIP have been shown to promote glucose sensitivity, neogenesis, proliferation, transcription of proinsulin and hypertrophy, as well as antiapoptosis. A peptide with dual agonistic activity for the GLP-1 and the GIP receptor could be anticipated to have additive or synergistic anti-diabetic benefit. Other relevant effects of GLP-1 beyond the pancreas include delayed gastric emptying, increased satiety, decreased food intake, reduction of body weight, as well as neuroprotective and cardioprotective effects. In patients with type 2 diabetes, such extrapancreatic effects could be particularly important considering the high rates of comorbidities like obesity and cardiovascular disease. Further GIP actions in peripheral tissues beyond the pancreas comprise increased bone formation and decreased bone resorption as well as neuroprotective effects which might be beneficial for the treatment of osteoporosis and cognitive defects like Alzheimer's disease.
Glucagon is a 29 amino acid peptide hormone that is produced by pancreatic alpha cells and released into the bloodstream when circulating glucose is low. An important physiological role of glucagon is to stimulate glucose output in the liver, which is a process providing the major counterregulatory mechanism for insulin in maintaining glucose homeostasis in vivo.
Glucagon receptors are however also expressed in extrahepatic tissues such as kidney, heart, adipocytes, lymphoblasts, brain, retina, adrenal gland and gastrointestinal tract, suggesting a broader physiological role beyond glucose homeostasis. Accordingly, recent studies have reported that glucagon has therapeutically positive effects on energy management, including stimulation of energy expenditure and thermogenesis, accompanied by reduction of food intake and body weight loss. Altogether, stimulation of glucagon receptors might be useful in the treatment of obesity and the metabolic syndrome.
Oxyntomodulin is a peptide hormone consisting of glucagon with an eight amino acids encompassing C-terminal extension. Like GLP-1 and glucagon, it is preformed in preproglucagon and cleaved and secreted in a tissue-specific manner by endocrinal cells of the small bowel. Oxyntomodulin is known to stimulate both, the receptors for GLP-1 and glucagon and is therefore the prototype of a dual agonist.
As GLP-1 and GIP are known for their anti-diabetic effects, GLP-1 and glucagon are both known for their food intake-suppressing effects and glucagon is also a mediator of additional energy expenditure, it is conceivable that a combination of the activities of the two or three hormones in one molecule can yield a powerful medication for treatment of the metabolic syndrome and in particular its components diabetes and obesity.
Accordingly, the compounds of the invention may be used for treatment of glucose intolerance, insulin resistance, pre-diabetes, increased fasting glucose, type 2 diabetes, hypertension, dyslipidemia, arteriosclerosis, coronary heart disease, peripheral artery disease, stroke or any combination of these individual disease components.
In addition, they may be used for control of appetite, feeding and calory intake, increase of energy expenditure, prevention of weight gain, promotion of weight loss, reduction of excess body weight and altogether treatment of obesity, including morbid obesity.
Further disease states and health conditions which could be treated with the compounds of the invention are obesity-linked inflammation, obesity-linked gallbladder disease and obesity-induced sleep apnea.
Although all these conditions could be associated directly or indirectly with obesity, the effects of the compounds of the invention may be mediated in whole or in part via an effect on body weight, or independent thereof.
Further, diseases to be treated are neurodegenerative diseases such as Alzheimer's disease or Parkinson's disease, or other degenerative diseases as described above.
Compared to GLP-1 , glucagon and oxyntomodulin, exendin-4 has beneficial physicochemical properties, such as solubility and stability in solution and under physiological conditions (including enzymatic stability towards degradation by enzymes, such as DPP-4 or NEP), which results in a longer duration of action in vivo. Therefore, exendin-4 might serve as good starting scaffold to obtain exendin-4 analogues with dual or even triple pharmacologies, e.g., GLP-1/GIP and optionally in addition glucagon agonism.
Nevertheless, also exendin-4 has been shown to be chemically labile due to methionine oxdiation in position 14 as well as deamidation and isomerization of asparagine in position 28. Therefore, stability might be further improved by substitution of methionine at position 14 and the avoidance of sequences that are known to be prone to degradation via aspartimide formation, especially Asp-Gly or Asn-Gly at positions 28 and 29.
Pharmaceutical compositions
The term "pharmaceutical composition" indicates a mixture containing ingredients that are compatible when mixed and which may be administered. A pharmaceutical composition may include one or more medicinal drugs. Additionally, the pharmaceutical composition may include carriers, buffers, acidifying agents, alkalizing agents, solvents, adjuvants, tonicity adjusters, emollients, expanders, preservatives, physical and chemical stabilizers e.g. surfactants, antioxidants and other components, whether these are considered active or inactive ingredients. Guidance for the skilled in preparing pharmaceutical compositions may be found, for example, in Remington: The Science and Practice of Pharmacy, (20th ed.) ed. A. R. Gennaro A. R., 2000, Lippencott Williams & Wilkins and in R.C.Rowe et al (Ed), Handbook of Pharmaceutical Excipients, PhP, May 2013 update.
The exendin-4 peptide derivatives of the present invention, or salts thereof, are administered in conjunction with an acceptable pharmaceutical carrier, diluent, or excipient as part of a pharmaceutical composition. A "pharmaceutically acceptable carrier" is a carrier which is physiologically acceptable (e.g. physiologically acceptable pH) while retaining the therapeutic properties of the substance with which it is administered. Standard acceptable pharmaceutical carriers and their formulations are known to one skilled in the art and described, for example, in Remington: The Science and Practice of Pharmacy, (20th ed.) ed. A. R. Gennaro A. R., 2000, Lippencott Williams & Wilkins and in R.C.Rowe et al (Ed), Handbook of Pharmaceutical excipients, PhP, May 2013 update. One exemplary pharmaceutically acceptable carrier is physiological saline solution.
In one embodiment carriers are selected from the group of buffers (e.g. citrate/citric acid), acidifying agents (e.g. hydrochloric acid), alkalizing agents (e.g. sodium hydroxide), preservatives (e.g. phenol), co-solvents (e.g. polyethylene glycol 400), tonicity adjusters (e.g. mannitol), stabilizers (e.g. surfactant, antioxidants, amino acids).
Example 5: In vitro data on GLP-1 , GIP and glucagon receptor
Potencies of peptidic compounds at the GLP-1 , GIP and glucagon receptors were determined by exposing cells expressing human glucagon receptor (hGLUC R), human GIP (hGIP R) and human GLP-1 receptor (hGLP-1 R) to the listed compounds at increasing concentrations and measuring the formed cAMP as described in Methods.
The results for Exendin-4 derivatives with activity at the human GIP (hGIP R), human GLP-1 receptor (hGLP-1 R) and human glucagon receptor (hGLUC R) are shown in Table 7.
Table 7. EC50 values of exendin-4 peptide analogues at GLP-1 , GIP and Glucagon receptors (indicated in pM)
EC50 hGIP R EC50 hGLP-1 R EC50 hGLUC R [pM] [pM] [pM]
SEQ ID NO:
26.0 8.7 803.0
8
9.0 5.5 445.0
9
14.4 5.2 667.0
10
14.4 3.8 66.9
1 1
8.0 5.5 139.0
12
26.3 14.1 20.2
13
6.2 6.5 62.3
14
11 .4 6.9 54.0
15
15.6 7.0 17000.0
16
8.3 5.2 21000.0
17
9.5 18.3 9.5
18
91 .5 8.5 137.0
19
16.3 8.2 18200.0
20
189.0 37.0 674.0
21
102.0 8.5 2215.0
22
134.5 9.2 312.0
23
10.4 19.2 284.0
176.0 37.0 2030.0
5.3 17.6 300.0
82.6 14.7 38.9
36.8 58.3 4.8
13.0 7.2 15000.0
16.3 5.0 1450.0
13.1 14.8 4.1
33.5 41 .7 19.2
88.2 8.1 109.0
51 .3 7.4 222.0
18.2 3.5 123.0
30.1 5.2 39.5
12.1 6.6 12100.0
7.4 9.0 22500.0
38.5 4.5 19.2
53.6 5.5 22.6
186.0 24.1 26.5
12.9 6.2 8470.0
48.2 7.0 114.0
25.5 9.7 55.2
23.4 11 .4 79.7
20.2 23.5 530.0
44.2 15.6 2390.0
15.8 10.1 477.5
45.6 17.2 195.0
47.9 10.0 1720.0
6.3 4.2 571 .0
182.0 25.6 13.3
93.2 13.6 7.9
105.0 66.8 2620.0 15.6 16.1 18300.0
55
162.0 4.6 19.9
56
15.7 7.1 14400.0
57
8.6 12.5 16000.0
58
59 17.5 7.5 12300.0
60 16.8 5.3 9.1
61 21.4 2.4 6.1
62 6.7 7.6 > 1000000
63 11.9 6.0 1670.0
64 9.6 10.2 75100.0
65 12.0 8.1 26800.0
66 82.6 3.6 5.2
Example 6: Pharnnacokinetic testing
Pharnnacokinetic profiles were determined as described in Methods. Calculated T/2 and cmax values are shown in Table 8.
Table 8. Pharmacokinetic profiles of exendin-4 derivatives.
Table 9: sequences
SEQ ID sequence
NO:
1 H-G-E-G-T-F-T-S-D-L-S-K-Q-M-E-E-E-A-V-R-L-F-l-E-W-L- K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
2 H-A-E-G-T-F-T-S-D-V-S-S-Y-L-E-G-Q-A-A-K-E-F-l-A-W-L- V-K-G-R-NH2
3 H-A-E-G-T-F-T-S-D-V-S-S-Y-L-E-G-Q-A-A-K(YE-X53)-E-F- l-A-W-L-V-R-G-R-G
Y-A-E-G-T-F-l-S-D-Y-S-l-A-M-D-K-l-H-Q-Q-D-F-V-N-W-L-L-A-Q-K-G-K-K-N-D-W-K-H-N-l-T-Q
H-S-Q-G-T-F-T-S-D-Y-S-K-Y-L-D-S-R-R-A-Q-D-F-V-Q-W-L-M-N-T
Y-G-E-G-T-F-T-S-D-L-S-l-Q-M-E-E-E-A-V-R-L-F-l-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-A-E-G-T-F-T-S-D-V-S-l-Y-L-E-G-Q-A-A-K-E-F-l-A-W-L-V-K-G-R-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-L-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-Aib-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-Y-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-Aib-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-A-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-Y-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-A-Aib-E-F-l-E-W-L-K-A-dAla-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-Q-R-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-S-K-A-A-Aib-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-K-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-E-K-E-A-A-Aib-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-H-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-K-R-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-L-A-Aib-E- F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-A-Aib-E-F-I-E-W-L-K-R-A-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-I-Q-K(x53)-E-Q-R-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-Aib-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-A-Aib-Y-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-V-Aib-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-I-Q-K(x53)-E-K-R-A-V-Aib-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-V-Aib-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-K-R-A-A-Aib-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-H-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-E-K-R-A-A-Aib-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-S-K-A-A-Aib-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-D-K-R-A-A-Q-D-F-I-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-D-E-Q-R-A-K-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-H-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-K-R-A-A-F-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-A-L-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-S-R-A-A-Q-D-F-I-E-W-L-K-R-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-E-R-A-A-K-D- F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-A-H-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-E-R-A-A-H-E-F-I-E-W-L-K-R-Aib-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-E-Q-A-A-H-E-F-I-E-W-L-K-R-Aib-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-E-S-K-A-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-E-S-K-A-A-Q-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(YE-x70)-D-S-K-A-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-S-K-A-A-Q-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-S-R-A-A-Q-D-F-I-E-W-L-K-K-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-K-R-A-A-Q-D-F-I-E-W-L-K-K-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-A-Q-L-F-I-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-V-Q-L-F-I-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-K-R-A-V-Q-L-F-I-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-S-E-A-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-S-l-A-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-S-R-A-V-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-S-R-A-Q-Q-D- F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-S-R-R-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-K-R-R-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-K-R-K-A-Q-D-F-I-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-D-K-R-A-A-Q-L-F-I-E-W-L-K-N-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-D-S-R-A-A-R-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-E-R-A-A-H-E-F-I-E-W-L-K-R-Aib-G-P-S-S-G-A-P-P-P-S-K-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-S-K-A-A-H-E-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-K-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x53)-E-K-R-A-A-H-E-F-I-E-W-L-K-N-T-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(YE-x70)-D-E-E-A-A-R-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-D-S-K-A-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-E-E-A-V-K-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-D-K-R-A-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-l-Q-K(YE-x70)-E-E-R-A-V-R-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-E-G-T-F-T-S-D-L-S-K-Q-K(YE-x70)-E-E-E-A-V-R-L-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Y-Aib-Q-G-T-F-T-S-D-L-S-K-Q-K(YE-x53)-D-S-R-A-A-Q-D-F-I-E-W-L-K-A-G-G-P-S-S-G-A-P-P-P-S-NH2
Claims
1 . A peptidic compound having the formula (I):
R1 - Z - R2 (I)
wherein Z is a peptide moiety having the formula (II)
Tyr-Aib-X3-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-X12-Gln-X14-X15-X16-X17-X18-X19-X20-X21 -Phe-lle-Glu-Trp-Leu-Lys-X28-X29-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-X40 (II)
X3 represents an amino acid residue selected from Gin, Glu and His,
X12 represents an amino acid residue selected from lie and Lys,
X14 represents an amino acid residue having a side chain with an -NH2 group, wherein the -NH2 side chain group is functionalized by - C(O)-R5, wherein R5 may be a moiety comprising up to 50 or up to 100 carbon atoms and optionally heteroatoms selected from halogen, N, O, S and/or P,
X15 represents an amino acid residue selected from Asp and Glu,
X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin, X17 represents an amino acid residue selected from Arg, Lys, Glu, lie, Gin, Leu, Aib, Tyr and Ala,
X18 represents an amino acid residue selected from Ala, Arg, Aib, Leu, Lys and Tyr,
X19 represents an amino acid residue selected from Ala, Gin, Val and Aib, X20 represents an amino acid residue selected from Gin, Aib, Phe, Arg, Leu, Lys and His,
X21 represents an amino acid residue selected from Asp, Glu, Tyr, and Leu, X28 represents an amino acid residue selected from Asn, Ala, Aib , Arg and Lys,
X29 represents an amino acid residue selected from Gly, Thr, Aib, D-Ala and Ala,
X40 is either absent or represents Lys,
R1 represents NH2,
R2 represents the C-terminal group of the peptidic compound and is selected from OH and NH2,
or a salt or solvate thereof.
2. A compound of claim 1 , wherein
X14 represents an amino acid residue with a functionalized -NH2 side chain group, such as functionalized Lys, Orn, Dab or Dap, wherein at least one H atom of the -NH2 side chain group is replaced by -C(O)-R5, which is selected from
(S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, 4-Hexadecanoylamino-butyryl-, 4-{3-[(R)-2,5,7,8-tetramethyl-2-((4R,8R)-4,8,12-trimethyl-tridecyl)-chroman-6-yloxycarbonyl]-propionylamino}-butyryl-, 4-octadecanoylamino-butyryl-, 4-((Z)-octadec-9-enoylamino)-butyryl-, 6-[(4,4-Diphenyl-cyclohexyloxy)-hydroxy-phosphoryloxy]-hexanoyl-, Hexadecanoyl-, (S)-4-Carboxy-4-(15-carboxy-pentadecanoylamino)-butyryl-, (S)-4-Carboxy-4-{3-[3-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylamino)-propionylamino]-propionylamino}-butyryl, (S)-4-Carboxy-4-{3-[(R)-2,5,7,8-tetramethyl-2-((4R,8R)-4,8,12-trimethyl-tridecyl)-chroman-6-yloxycarbonyl]-propionylamino}-butyryl-, (S)-4-Carboxy-4-((9Z,12Z)-octadeca-9,12-dienoylamino)-butyryl-, (S)-4-Carboxy-4-[6-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylamino)-hexanoylamino]-butyryl-, (S)-4-Carboxy-4-((2S,3R,4S,5R)-5-carboxy-2,3,4,5-tetrahydroxy-pentanoylamino)-butyryl-, (S)-4-Carboxy-4-tetradecanoylamino-butyryl-, (S)-4-(1 1 -Benzyloxycarbonyl-undecanoylamino)-4-carboxy-butyryl-, (S)-4-Carboxy-4-[1 1 -((2S,3R,4R,5R)-2,3,4,5,6-pentahydroxy-hexylcarbamoyl)-undecanoylamino]-butyryl-, (S)-4-Carboxy-4-((Z)-octadec-9-enoylamino)-butyryl-, (S)-4-Carboxy-4-(4-dodecyloxy-benzoylamino)-butyryl-, (S)-4- Carboxy-4-henicosanoylamino-butyryl-, (S)-4-Carboxy-4-docosanoylamino-butyryl-, (S)-4-Carboxy-4-((Z)-nonadec-10-enoylamino)-butyryl-, (S)-4-Carboxy-4-(4-decyloxy-benzoylamino)-butyryl-, (S)-4-Carboxy-4-[(4'-octyloxy-biphenyl-4-carbonyl)-amino]-butyryl-, (S)-4-Carboxy-4-(12-phenyl-dodecanoylamino)-butyryl-, (S)-4-Carboxy-4-icosanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-hexadecanoylamino-butyrylannino)-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-octadecanoylamino-butyrylannino)-butyryl-, 3-(3-Octadecanoylamino-propionylannino)-propionyl-, 3-(3-Hexadecanoylamino-propionylannino)-propionyl-, 3-Hexadecanoylamino-propionyl-, (S)-4-Carboxy-4-[(R)-4-((3R,5S,7R,8R,9R,10S,12S,13R,14R,17R)-3,7,12-trihydroxy-8,10,13-trimethyl-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-pentanoylamino]-butyryl-, (S)-4-Carboxy-4-[(R)-4-((3R,5R,8R,9S,10S,13R,14S,17R)-3-hydroxy-10,13-dimethyl-hexadecahydro-cyclopenta[a]phenanthren-17-yl)-pentanoylamino]-butyryl-, (S)-4-Carboxy-4-((9S,10R)-9,10,16-trihydroxy-hexadecanoylamino)-butyryl-, tetradecanoyl-, 1 1 -Carboxy-undecanoyl-, 1 1 -Benzyloxycarbonyl-undecanoyl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-tetradecanoylamino-butyrylannino)-butyryl-, 6-[Hydroxy-(naphthalen-2-yloxy)-phosphoryloxy]-hexanoyl-, 6-[Hydroxy-(5-phenyl-pentyloxy)-phosphoryloxy]-hexanoyl-, 4-(Naphthalene-2-sulfonylamino)-4-oxo-butyryl-, 4-(Biphenyl-4-sulfonylamino)-4-oxo-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylamino}-butyryl-, (S)-4-Carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyryl-, (S)-4-Carboxy-2-{(S)-4-carboxy-2-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylamino}-butyryl-, (S)-4-Carboxy-2-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}- ethoxy)-acetylamino]-butyrylannino}-butyryl-, (S)-4-Carboxy-4-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-butyryl-,(S)-4-Carboxy-2-{(S)-4-carboxy-2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-butyrylamino}-butyryl-, (S)-4-Carboxy-2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-butyryl-, 2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl-, 2-(2-{2-[(S)-4-Carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetyl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-{(S)-4-carboxy-4-[(S)-4-carboxy-4-(19-carboxy-nonadecanoylamino)-butyrylamino]-butyrylamino}-butyrylamino)-butyryl-, 2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(16-1 H-tetrazol-5-yl-hexadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl-, 2-(2-{2-[2-(2-{2-[(S)-4-Carboxy-4-(16-carboxy-hexadecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)-butyrylamino]-butyrylamino}-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-{2-[2-(2-{2-[2-(2-{(S)-4-carboxy-4-[10-(4-carboxy-phenoxy)-decanoylamino]-butyrylannino}-ethoxy)-ethoxy]-acetylamino}-ethoxy)-ethoxy]-acetylannino}-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(7-carboxy-heptanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylaminoj-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(1 1 -carboxy-undecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylannino]-butyrylannino}-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(13-carboxy-tridecanoylamino)-butyrylannino]-ethoxy}-ethoxy)-acetylannino]-ethoxy}-ethoxy)-acetylamino]-butyrylannino}-butyryl-, (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(15-carboxy-pentadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylannino}-butyryl-, and (S)-4-Carboxy-4-{(S)-4-carboxy-4-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(19-carboxy-
nonadecanoylamino)-butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetylamino]-butyrylannino}-butyryl-,
X40 is absent or represents Lys.
3. A compound of any one of claims 1 - 2, wherein
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-, 4-octadecanoylamino-butyryl-, Hexadecanoyl-, (S)-4-Carboxy-4-henicosanoylamino-butyryl-, (S)-4-Carboxy-4-((S)-4-carboxy-4-octadecanoylamino-butyrylamino)-butyryl-, 3-(3-Octadecanoylamino-propionylamino)-propionyl-.
4. A compound according to any one of claims 1 -3,
wherein X14 is Lys functionalized with C(O)-R5, wherein R5 is selected from the group consisting of (S)-4-carboxy-4-hexadecanoylamino-butyryl (γΕ-x53), (S)-4-carboxy-4-octadecanoylamino-butyryl (γΕ-χ70), and Hexadecanoyl (x53).
5. A compound of any one of claims 1 - 4,
wherein R2 is NH2.
6. A compound according to any one of claims 1 -5,
wherein the peptidic compound has a relative activity of at least 0.04%, preferably at least 0.08%, more preferably at least 0.2% compared to that of natural GIP at the GIP receptor.
7. A compound according to any one of claims 1 -6, wherein the peptidic compound exhibits a relative activity of at least 0.07%, preferably at least 0.1 %, more preferably at least 0.14%, more preferably at least 0.35% and even more preferably at least 0.4% compared to that of
GLP-1 (7-36) at the GLP-1 receptor.
8. A compound according to any one of claims 6 or 7, wherein the peptidic compound further exhibits a relative activity of at least 0.1 %, preferably at least 0.2%, more preferably at least 0.3%, more preferably at least 0.4% and even more preferably at least 0.5% compared to that of natural glucagon at the glucagon receptor.
9. A compound of any one of claims 1 - 8,
wherein
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, (S)-4-Carboxy-4-octadecanoylamino-butyryl-.
10. A compound of any one of claims 1 - 9,
wherein
X3 represents an amino acid residue selected from Gin, His and Glu,
X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, hexadecanoyl- and (S)-4-Carboxy-4-octadecanoylamino-butyryl-, X15 represents an amino acid residue selected from Glu and Asp,
X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin, X17 represents an amino acid residue selected from Arg, Leu, Aib, Tyr, Glu, Ala and Lys,
X18 represents an amino acid residue selected from Ala, Aib, Leu and Tyr, X19 represents an amino acid residue selected from Ala, Val and Aib, X20 represents Aib,
X21 represents an amino acid residue selected from Glu, Leu and Tyr, X28 represents an amino acid residue selected from Asn, Arg and Ala, X29 represents an amino acid residue selected from Gly, Ala, D-Ala and Thr, X40 is either absent or represents Lys.
1 1 .A compound of any one of claims 1 - 9
X3 represents an amino acid residue selected from Gin, His and Glu, X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl- and (S)-4-Carboxy-4-octadecanoylamino-butyryl-,
X15 represents an amino acid residue selected from Glu and Asp,
X16 represents an amino acid residue selected from Ser, Lys and Glu,
X17 represents an amino acid residue selected from Arg, Lys, lie, Glu and
Gin,
X18 represents an amino acid residue selected from Ala, Arg and Lys, X19 represents an amino acid residue selected from Ala, Val and Gin, X20 represents an amino acid residue selected from Gin, Phe, Leu, Lys, His and Arg,
X21 represents an amino acid residue selected from Glu, Asp and Leu, X28 represents an amino acid residue selected from Asn, Arg, Lys and Ala, X29 represents an amino acid residue selected from Gly, Aib and Thr, X40 is either absent or represents Lys.
12. A compound of any one of claims 1 - 1 1 ,
wherein X19 represents Ala.
13. A compound of any one of claims 1 - 12,
wherein
X28 represents Ala,
X29 represents Gly.
14. A compound of any one of claims 1 - 12,
wherein
X28 represents Asn,
X29 represents Thr.
15. The peptidic compound according to any one of claims 1 - 14,
wherein
X3 represents an amino acid residue selected from Gin, His and Glu,
X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl-, hexadecanoyl- and (S)-4-Carboxy-4-octadecanoylamino-butyryl-, X15 represents an amino acid residue selected from Glu and Asp,
X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin, X17 represents an amino acid residue selected from Arg, Leu, Aib, Tyr, Glu, Ala and Lys,
X18 represents an amino acid residue selected from Ala, Aib, Leu and Tyr, X19 represents an amino acid residue selected from Ala, Val and Aib, X20 represents Aib,
X21 represents an amino acid residue selected from Glu, Leu and Tyr, X28 represents an amino acid residue selected from Asn, Arg and Ala,
X29 represents an amino acid residue selected from Gly, Ala, D-Ala and Thr, X40 is either absent or represents Lys;
or wherein
X3 represents an amino acid residue selected from Gin, His and Glu,
X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by one of the groups selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl- and (S)-4-Carboxy-4-octadecanoylamino-butyryl-,
X15 represents an amino acid residue selected from Glu and Asp,
X16 represents an amino acid residue selected from Ser, Lys and Glu,
X17 represents an amino acid residue selected from Arg, Lys, lie, Glu and Gin,
X18 represents an amino acid residue selected from Ala, Arg and Lys, X19 represents an amino acid residue selected from Ala, Val and Gin, X20 represents an amino acid residue selected from Gin, Phe, Leu, Lys, His and Arg,
X21 represents an amino acid residue selected from Glu, Asp and Leu,
X28 represents an amino acid residue selected from Asn, Arg, Lys and Ala, X29 represents an amino acid residue selected from Gly, Aib and Thr, X40 is either absent or represents Lys.
16. A compound of any one of claims 1 - 15, wherein
X3 represents an amino acid residue selected from Gin, His and Glu,
X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by -C(O)-R5, wherein R5 is selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl- (γΕ-χ53), (S)-4-Carboxy-4-octadecanoylamino-butyryl- (γΕ-χ70) and Hexadecanoyl- (x53),
X15 represents an amino acid residue selected from Glu and Asp,
X16 represents an amino acid residue selected from Ser, Lys, Glu and Gin, X17 represents an amino acid residue selected from Arg, Leu, Aib, Tyr, Glu, Ala, Lys, lie and Gin
X18 represents an amino acid residue selected from Ala, Aib, Leu, Tyr, Arg and Lys
X19 represents an amino acid residue selected from Ala, Val, Aib, and Gin, X20 represents an amino acid residue selected from Aib, Gin, Phe, Leu, Lys, His and Arg,
X21 represents an amino acid residue selected from Glu, Leu, Tyr and Asp, X28 represents an amino acid residue selected from Asn, Arg, Ala and Lys, X29 represents an amino acid residue selected from Gly, Ala, D-Ala, Thr and Aib,
X40 is either absent or represents Lys.
17. A compound of any one of claims 1 -10, 12-16, wherein
X3 represents an amino acid residue selected from Gin, His and Glu,
X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by -C(O)-R5, wherein R5 is selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl- (γΕ-χ53), (S)-4-Carboxy-4-octadecanoylamino-butyryl- (γΕ-χ70) and Hexadecanoyl- (x53),
X15 represents an amino acid residue selected from Glu and Asp,
X16 represents an amino acid residue selected from Ser, Lys and Gin, X17 represents an amino acid residue selected from Arg, Leu, Aib, Tyr, Glu, Ala and Lys,
X18 represents an amino acid residue selected from Ala, Aib, Leu and Tyr, X19 represents an amino acid residue selected from Ala, Val and Aib, X20 represents Aib,
X21 represents an amino acid residue selected from Glu, Leu and Tyr, X28 represents an amino acid residue selected from Asn, Arg and Ala,
X29 represents an amino acid residue selected from Gly, Ala, D-Ala and Thr, X40 is either absent or represents Lys.
18. A compound of any one of claims 1 -9, 1 1 -16, wherein
X3 represents an amino acid residue selected from Gin, His and Glu,
X12 represents an amino acid residue selected from lie and Lys,
X14 represents Lys, wherein the -NH2 side chain group is functionalized by -C(O)-R5, wherein R5 is selected from (S)-4-Carboxy-4-hexadecanoylamino-butyryl- (γΕ-χ53) and (S)-4-Carboxy-4-octadecanoylamino-butyryl- (γΕ-χ70), X15 represents an amino acid residue selected from Glu and Asp,
X16 represents an amino acid residue selected from Ser, Lys, Glu,
X17 represents an amino acid residue selected from Arg, Glu, Lys, lie and Gin
X18 represents an amino acid residue selected from Ala, Arg and Lys
X19 represents an amino acid residue selected from Ala, Val and Gin,
X20 represents an amino acid residue selected from Gin, Phe, Leu, Lys, His and Arg,
X21 represents an amino acid residue selected from Glu, Leu and Asp, X28 represents an amino acid residue selected from Asn, Arg, Ala and Lys, X29 represents an amino acid residue selected from Gly, Thr and Aib, X40 is either absent or represents Lys.
19. The compound of any one of claims 1 -18, selected from the compounds of SEQ ID NO: 8-66 or a salt or solvate thereof.
20. The compound of any one of claims 1 -18, selected from the compounds of SEQ ID NO: 8-27, 29-61 and 66 or a salt or solvate thereof.
21 . The compound of any one of claims 1 -10, 12-17, 19, selected from the compounds of SEQ ID NO: 8-29 or a salt or solvate thereof.
22. The compound of any one of claims 1 -10, 12-17, 20, selected from the compounds of SEQ ID NO: 8-27 and 29 or a salt or solvate thereof.
23. The compound of any one of claims 1 -9, 1 1 -16, 18-19, selected from the compounds of SEQ ID NO: 30-66 or a salt or solvate thereof.
24. The compound of any one of claims 1 -9, 1 1 -16, 18, 20, selected from the compounds of SEQ ID NO: 30-61 and 66 or a salt or solvate thereof.
25. The compound of any one of claims 1 -24 for use in medicine, particularly in human medicine.
26. The compound for use according to claim 25 which is present as an active agent in a pharmaceutical composition together with at least one pharmaceutically acceptable carrier.
27. The compound for use according to claim 25 or 26 together with at least one additional therapeutically active agent, wherein the additional therapeutically active agent is selected from the series of Insulin and Insulin derivatives, GLP-1 , GLP-1 analogues and GLP-1 receptor agonists, polymer bound GLP-1 and GLP-1 analogues, dual GLP1 /glucagon agonists, PYY3-36 or analogues thereof, pancreatic polypeptide or analogues thereof, Glucagon receptor agonists, GIP receptor agonists or antagonists, ghrelin antagonists or inverse agonists, Xenin and analogues thereof, DDP-IV inhibitors, SGLT2 inhibitors, dual SGLT2 / SGLT1 inhibitors, Biguanides Thiazolidinediones, dual PPAR agonists, Sulfonylureas, Meglitinides, alpha-glucosidase inhibitors, Amylin and Amylin analogues, GPR1 19 agonists, GPR40 agonists, GPR120 agonists, GPR142 agonists, systemic or low-absorbable TGR5 agonists, Cycloset, inhibitors of 1 1 -beta-HSD, activators of glucokinase, inhibitors of DGAT, inhibitors of protein tyrosinephosphatase 1 , inhibitors of glucose-6-phosphatase, inhibitors of fructose-1 ,6-bisphosphatase, inhibitors of glycogen phosphorylase, inhibitors of phosphoenol pyruvate carboxykinase, inhibitors of glycogen synthase kinase, inhibitors of pyruvate dehydrogenase kinase, alpha2-antagonists, CCR-2 antagonists, modulators of glucose transporter-4, Somatostatin receptor 3 agonists, HMG-CoA-reductase inhibitors, fibrates, nicotinic acid and the derivatives thereof, nicotinic acid receptor 1 agonists, PPAR-alpha, gamma or alpha/gamma) agonists or modulators, PPAR-delta agonists, ACAT inhibitors, cholesterol absorption inhibitors, bile acid-binding substances, IBAT inhibitors, MTP inhibitors, modulators of PCSK9, LDL receptor up-regulators by liver selective thyroid hormone receptor β agonists, HDL-raising compounds, lipid metabolism modulators, PLA2 inhibitors , ApoA-l enhancers, thyroid hormone receptor agonists, cholesterol synthesis inhibitors, omega-3 fatty acids and derivatives thereof, active substances for the treatment of obesity, such as Sibutramine, Tesofensine, Orlistat, CB-1 receptor antagonists, MCH-1 antagonists, MC4 receptor agonists and partial agonists, NPY5 or NPY2 antagonists, NPY4 agonists, beta-3-agonists, leptin or leptin mimetics, agonists of the 5HT2c receptor, or the combinations of bupropione/naltrexone (CONTRAVE),
bupropione/zonisamide (EMPATIC), bupropione/phentermine or pramlintide/metreleptin, QNEXA (Phentermine+ topiramate), lipase inhibitors, angiogenesis inhibitors, H3 antagonists, AgRP inhibitors, triple monoamine uptake inhibitors (norepinephrine and acetylcholine), MetAP2 inhibitors, nasal formulation of the calcium channel blocker diltiazem, antisense against production of fibroblast growth factor receptor 4, prohibitin targeting peptide-1 , drugs for influencing high blood pressure, chronic heart failure or atherosclerosis, such as angiotensin II receptor antagonists, ACE inhibitors, ECE inhibitors, diuretics, beta-blockers, calcium antagonists, centrally acting hypertensives, antagonists of the alpha- 2-adrenergic receptor, inhibitors of neutral endopeptidase, thrombocyte aggregation inhibitors.
28. The compound for use according to claim 25 or 26 together with at least one additional therapeutically active agent, wherein the additional therapeutically active agent particularly is a GLP-1 agonist and/or insulin or an insulin analogue and/or a gastrointestinal peptide.
29. The compound for use according to any one of claims 25-28 for the treatment or prevention of hyperglycemia, type 2 diabetes, impaired glucose tolerance, type 1 diabetes, obesity, metabolic syndrome and neurodegenerative disorders, particularly for delaying or preventing disease progression in type 2 diabetes, treating metabolic syndrome, treating obesity or preventing overweight, for decreasing food intake, increase energy expenditure, reducing body weight, delaying the progression from impaired glucose tolerance (IGT) to type 2 diabetes; delaying the progression from type 2 diabetes to insulin-requiring diabetes; regulating appetite; inducing satiety; preventing weight regain after successful weight loss; treating a disease or state related to overweight or obesity; treating bulimia; treating binge eating; treating atherosclerosis, hypertension, IGT, dyslipidemia, coronary heart disease, hepatic steatosis, treatment of beta-blocker poisoning, use for inhibition of the motility of the gastro-intestinal tract, useful in connection with investigations of the gastro-intestinal tract using techniques such as X-ray, CT- and NMR-scanning.
30. The compound for use according to any one of claims 25-29 for the treatment or prevention of hyperglycemia, type 2 diabetes, obesity and metabolic syndrome or reducing body weight.
| # | Name | Date |
|---|---|---|
| 1 | 2104-KOLNP-2015-(01-07-2015)-PCT SEARCH REPORT & OTHERS.pdf | 2015-07-01 |
| 1 | 2104-KOLNP-2015-AbandonedLetter.pdf | 2020-01-16 |
| 2 | 2104-KOLNP-2015-(01-07-2015)-OTHERS.pdf | 2015-07-01 |
| 2 | 2104-KOLNP-2015-FER.pdf | 2019-06-28 |
| 3 | Form 18 [08-12-2016(online)].pdf | 2016-12-08 |
| 3 | 2104-KOLNP-2015-(01-07-2015)-INTERNATIONAL PUBLICATION.pdf | 2015-07-01 |
| 4 | Other Patent Document [29-11-2016(online)].pdf | 2016-11-29 |
| 4 | 2104-KOLNP-2015-(01-07-2015)-GPA.pdf | 2015-07-01 |
| 5 | 2104-KOLNP-2015-(15-12-2015)-ANNEXURE TO FORM 3.pdf | 2015-12-15 |
| 5 | 2104-KOLNP-2015-(01-07-2015)-FORM-5.pdf | 2015-07-01 |
| 6 | 2104-KOLNP-2015-(15-12-2015)-ASSIGNMENT.pdf | 2015-12-15 |
| 6 | 2104-KOLNP-2015-(01-07-2015)-FORM-3.pdf | 2015-07-01 |
| 7 | 2104-KOLNP-2015-(15-12-2015)-CORRESPONDENCE.pdf | 2015-12-15 |
| 7 | 2104-KOLNP-2015-(01-07-2015)-FORM-2.pdf | 2015-07-01 |
| 8 | 2104-KOLNP-2015-WO2014096145A1.pdf | 2015-11-06 |
| 8 | 2104-KOLNP-2015-(01-07-2015)-FORM-1.pdf | 2015-07-01 |
| 9 | 2090-KOLNP-2012-(23-09-2015)-ANNEXURE TO FORM 3.pdf | 2015-09-23 |
| 9 | 2104-KOLNP-2015-(01-07-2015)-CORRESPONDENCE.pdf | 2015-07-01 |
| 10 | 2104-KOLNP-2015-(01-07-2015)-CLAIMS.pdf | 2015-07-01 |
| 10 | 2104-KOLNP-2015-(23-09-2015)-FORM-13.pdf | 2015-09-23 |
| 11 | 2104-KOLNP-2015-(01-07-2015)-AMENDED CLAIMS.pdf | 2015-07-01 |
| 11 | 2190-KOLNP-2015-(23-09-2015)-AMANDED PAGES OF SPECIFICATION.pdf | 2015-09-23 |
| 12 | 2190-KOLNP-2015-(23-09-2015)-FORM-13.pdf | 2015-09-23 |
| 12 | 2190-KOLNP-2015-(23-09-2015)-OTHERS.pdf | 2015-09-23 |
| 13 | 2190-KOLNP-2015-(23-09-2015)-FORM-13.pdf | 2015-09-23 |
| 13 | 2190-KOLNP-2015-(23-09-2015)-OTHERS.pdf | 2015-09-23 |
| 14 | 2104-KOLNP-2015-(01-07-2015)-AMENDED CLAIMS.pdf | 2015-07-01 |
| 14 | 2190-KOLNP-2015-(23-09-2015)-AMANDED PAGES OF SPECIFICATION.pdf | 2015-09-23 |
| 15 | 2104-KOLNP-2015-(01-07-2015)-CLAIMS.pdf | 2015-07-01 |
| 15 | 2104-KOLNP-2015-(23-09-2015)-FORM-13.pdf | 2015-09-23 |
| 16 | 2090-KOLNP-2012-(23-09-2015)-ANNEXURE TO FORM 3.pdf | 2015-09-23 |
| 16 | 2104-KOLNP-2015-(01-07-2015)-CORRESPONDENCE.pdf | 2015-07-01 |
| 17 | 2104-KOLNP-2015-WO2014096145A1.pdf | 2015-11-06 |
| 17 | 2104-KOLNP-2015-(01-07-2015)-FORM-1.pdf | 2015-07-01 |
| 18 | 2104-KOLNP-2015-(15-12-2015)-CORRESPONDENCE.pdf | 2015-12-15 |
| 18 | 2104-KOLNP-2015-(01-07-2015)-FORM-2.pdf | 2015-07-01 |
| 19 | 2104-KOLNP-2015-(15-12-2015)-ASSIGNMENT.pdf | 2015-12-15 |
| 19 | 2104-KOLNP-2015-(01-07-2015)-FORM-3.pdf | 2015-07-01 |
| 20 | 2104-KOLNP-2015-(15-12-2015)-ANNEXURE TO FORM 3.pdf | 2015-12-15 |
| 20 | 2104-KOLNP-2015-(01-07-2015)-FORM-5.pdf | 2015-07-01 |
| 21 | Other Patent Document [29-11-2016(online)].pdf | 2016-11-29 |
| 21 | 2104-KOLNP-2015-(01-07-2015)-GPA.pdf | 2015-07-01 |
| 22 | Form 18 [08-12-2016(online)].pdf | 2016-12-08 |
| 22 | 2104-KOLNP-2015-(01-07-2015)-INTERNATIONAL PUBLICATION.pdf | 2015-07-01 |
| 23 | 2104-KOLNP-2015-FER.pdf | 2019-06-28 |
| 23 | 2104-KOLNP-2015-(01-07-2015)-OTHERS.pdf | 2015-07-01 |
| 24 | 2104-KOLNP-2015-AbandonedLetter.pdf | 2020-01-16 |
| 24 | 2104-KOLNP-2015-(01-07-2015)-PCT SEARCH REPORT & OTHERS.pdf | 2015-07-01 |
| 1 | strategy_27-06-2019.pdf |