FIBROBLAST GROWTHFACTOR 21 PROTEINS
This present invention relates to fibroblast growth factor 2 1 (FGF21) proteins,
pharmaceutical compositions comprising FGF21 proteins, and methods for treating type 2
diabetes, obesity, dyslipidemia, and/or metabolic syndrome.
FGF21 is a hormone that functions as an important metabolic regulator of glucose
and lipid homeostasis. FGF21 promotes glucose uptake in adipocytes by up-regulating
GLUT1 expression, a mechanism distinct from that of insulin. In diabetic rodents and
monkeys, human FGF21 lowered fasting serum concentrations of glucose, and reduced
fasting serum concentrations of triglycerides, insulin and glucagon. Furthermore, in
rodent models of diet induced obesity, FGF21 administration led to cumulative body
weight loss in a dose dependent manner. Thus, FGF21 has potential utility for the
treatment of diabetes, obesity, dyslipidemia, and metabolic syndrome.
FGF21 proteins have been described in WO20 10/042747, WO2010/285131, and
WO2009/149171.
Problems associated with human wild type FGF21 and known FGF21 proteins are
a short half-life in vivo, a low potency and/or pharmaceutical instability of the molecules.
Thus, there is still a need for alternative FGF21 proteins that are long-acting, potent
and/or stable.
The present invention provides alternative FGF21 proteins. Certain FGF21
proteins of the present invention have advantages over human wild type FGF21 and
known FGF21 proteins disclosed in the art. These advantages include having an extended
half-life, improved potency and/or improved pharmaceutical stability. In addition to
improved potency, certain FGF2 1 proteins of the present invention have one or more
advantageous stability characteristics that are useful for efficient manufacturing and/or
formulation as a therapeutic protein, including reduced proteolytic degradation in vivo,
reduced susceptibility to oxidation, lowered propensity to aggregate at high
concentrations, lowered levels of post-translational modifications and proteolysis during
production in mammalian cell systems, and/or improved chemical stability. Additionally,
the FGF2 1proteins of the present invention are potentially useful for the treatment of
type 2 diabetes, obesity, dyslipidemia, and/or metabolic syndrome.
The present invention provides a FGF21 protein, wherein the amino acid sequence
consists of a first polypeptide fused to a second polypeptide, wherein the first polypeptide
comprises an IgG4 Fc portion, wherein the Fc portion consists of a hinge region, CH2 and
CH3 constant region domains of an antibody, the second polypeptide comprises a FGF2 1
protein having the amino acid sequence of SEQ ID NO: 1, and wherein the C-terminus of
the first polypeptide is fused to the N-terminus of the second polypeptide via a linker.
Furthermore, the present invention provides a FGF2 1protein, wherein the amino
acid sequence consists of a first polypeptide fused to a second polypeptide, wherein the
first polypeptide comprises an IgG4 Fc portion having the amino acid sequence of SEQ
ID NO: 14, the second polypeptide comprises a FGF21 protein having the amino acid
sequence of SEQ ID NO: 1, and wherein the C-terminus of the first polypeptide is fused
to the N-terminus of the second polypeptide via a linker.
The present invention also provides a FGF21 protein, wherein the amino acid
sequence consists of a first polypeptide fused to a second polypeptide, wherein the first
polypeptide comprises an IgG4 Fc portion having the amino acid sequence of SEQ ID
NO: 14, the second polypeptide comprises a FGF21 protein having the amino acid
sequence of SEQ ID NO: 1, and wherein the C-terminus of the first polypeptide is fused
to the N-terminus of the second polypeptide via a linker having the amino acid sequence
of SEQ ID NO: 11.
The present invention provides a FGF21 protein, wherein the amino acid sequence
is
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLOFGGOVRORYLYTDD
AOOTECHLEIREDGTVGCAADOSPESLLOLKALKPGVIOILGVKTSRFLCORPDG
ALYGSLHFDPEACSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPA
RFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLRSPSFE (SEQ ID NO: 5).
The FGF21 protein of SEQ ID NO: 5 described above includes the IgG4 Fc
portion sequence of SEQ ID NO: 14, the linker sequence of SEQ ID NO: 11 that is
identified in bold, and the FGF21 protein of SEQ ID NO: 1 that is underlined.
Furthermore, the present invention provides a FGF21 protein, wherein the amino
acid sequence is
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFREXiLX 2EDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLP
LPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLX3SPSFX4X5 (SEQ ID NO: 15)
wherein Xi is L or D, X2 is L or K, X is R or L, X4 is L or E, and X is G or is absent.
The present invention also provides a FGF21 protein of SEQ ID NO: 15, wherein the Xi
is D, X 2 is L or K, X 3 is L, X4 is L, and X 5 is G. Furthermore, the present invention
provides a FGF21 protein of SEQ ID NO: 15, wherein Xi is L or D, X2 is L or K, X is R,
X4 is E, and X 5 is absent.
The present invention provides a FGF21 protein of SEQ ID NO: 15, wherein the
FGF21 protein is selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6,
SEQ ID NO: 7, SEQ ID NO: 8, and SEQ ID NO: 9. The present invention also provides
a FGF21 protein of SEQ ID NO: 15, wherein the FGF21 protein is selected from the
group consisting of SEQ ID NO: 8 and SEQ ID NO: 9. Furthermore, the present
invention provides a FGF21 protein of SEQ ID NO: 15, wherein the FGF21 protein is
selected from the group consisting of SEQ ID NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7.
The most preferred FGF21 protein is SEQ ID NO: 5.
The present invention also provides a pharmaceutical composition comprising a
FGF21 protein of the present invention and at least one pharmaceutically acceptable
carrier, diluent, or excipient.
The present invention also provides a method of treating type 2 diabetes, obesity,
dyslipidemia, and/or metabolic syndrome in a patient comprising administering to the
patient a FGF21 protein of the present invention.
The present invention also provides a method of treating type 2 diabetes, obesity,
dyslipidemia, and/or metabolic syndrome in a patient comprising administering to the
patient a pharmaceutical composition of the present invention.
Furthermore, the present invention provides a FGF21 protein of the present
invention for use in therapy. Preferably, the present invention provides a FGF21 protein
of the present invention for use in the treatment of type 2 diabetes, obesity, dyslipidemia,
and/or metabolic syndrome.
Furthermore, the present invention provides the use of a FGF21 protein of the
present invention in the manufacture of a medicament for the treatment of type 2 diabetes,
obesity, dyslipidemia, and/or metabolic syndrome.
The present invention also relates to polynucleotides encoding the abovedescribed
FGF21 protein of the present invention.
Furthermore, the present invention provides a polynucleotide encoding the FGF21
protein of the present invention, wherein the amino acid sequence of the FGF21 protein
consists of a first polypeptide fused to a second polypeptide, wherein the first polypeptide
comprises an IgG4 Fc portion, wherein the Fc portion consists of a hinge region, CH2 and
CH3 constant region domains of an antibody, the second polypeptide comprises a FGF2 1
protein having the amino acid sequence of SEQ ID NO: 1, and wherein the C-terminus of
the first polypeptide is fused to the N-terminus of the second polypeptide via a linker.
The present invention also provides a polynucleotide encoding the FGF21 protein
of the present invention, wherein the amino acid sequence of the FGF21 protein consists
of a first polypeptide fused to a second polypeptide, wherein the first polypeptide
comprises an IgG4 Fc portion having the amino acid sequence of SEQ ID NO: 14, the
second polypeptide comprises a FGF21 protein having the amino acid sequence of SEQ
ID NO: 1, and wherein the C-terminus of the first polypeptide is fused to the N-terminus
of the second polypeptide via a linker.
Furthermore, the present invention provides a polynucleotide encoding the FGF21
protein of the present invention, wherein the amino acid sequence of the FGF21 protein
consists of a first polypeptide fused to a second polypeptide, wherein the first polypeptide
comprises an IgG4 Fc portion having the amino acid sequence of SEQ ID NO: 14, the
second polypeptide comprises a FGF21 protein having the amino acid sequence of SEQ
ID NO: 1, and wherein the C-terminus of the first polypeptide is fused to the N-terminus
of the second polypeptide via a linker having the amino acid sequence of SEQ ID NO: 11.
Furthermore, the present invention provides a polynucleotide encoding the FGF21
protein of the present invention, wherein the amino acid sequence of the FGF21 protein is
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSQE
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKC
KVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDI
AVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEA
LHNHYTQKSLSLSLGGGGGSGGGGSGGGGSA HPIPDSSPLLQFGGQVRQRYL
YTDDAOOTECHLEIREDGTVGCAADOSPESLLOLKALKPGVIOILGVKTSRFLCO
RPDGALYGSLHFDPEACSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAP
RGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLRSPSFE (SEQ ID
NO: 5).
The present invention also provides a polynucleotide encoding the FGF21 protein
of the present invention, wherein the nucleotide sequence is SEQ ID NO: 13.
The polynucleotides encoding the above-described proteins may be in the form of
RNA or in the form of DNA, which DNA includes cDNA, and synthetic DNA. The
DNA may be double-stranded or single-stranded. The coding sequences that encode the
proteins of the present invention may vary as a result of the redundancy or degeneracy of
the genetic code.
The polynucleotides that encode for the proteins of the present invention may
include the following: only the coding sequence for the proteins, the coding sequence for
the proteins and additional coding sequence, such as a leader or secretory sequence or a
pro-protein sequence; the coding sequence for the proteins and non-coding sequence,
such as introns or non-coding sequence 5' and/or 3' of the coding sequence for the
proteins. Thus the term "polynucleotide encoding a protein" encompasses a
polynucleotide that may include not only coding sequence for the proteins but also a
polynucleotide that includes additional coding and/or non-coding sequence, such as SEQ
ID NO: 13.
The polynucleotides of the present invention will be expressed in a host cell after
the sequences have been operably linked to an expression control sequence. The
expression vectors are typically replicable in the host organisms either as episomes or as
an integral part of the host chromosomal DNA. Commonly, expression vectors will
contain selection markers, e.g., tetracycline, neomycin, and dihydrofolate reductase, to
permit detection of those cells transformed with the desired DNA sequences.
The FGF21 proteins of the present invention may readily be produced in
mammalian cells such as CHO, NSO, HEK293 or COS cells; in bacterial cells such as E.
coli, Bacillus subtilis, or Pseudomonas fluorescence; or in fungal or yeast cells. The host
cells are cultured using techniques well known in the art. The preferred mammalian host
cell is the CHOKISV cell line containing a glutamine synthetase (GS) expression system
(see US 5,122,464).
The vectors containing the polynucleotide sequences of interest (e.g., the proteins
of FGF21 and expression control sequences) can be transferred into the host cell by wellknown
methods, which vary depending on the type of cellular host. For example,
calcium chloride transformation is commonly utilized for prokaryotic cells, whereas
calcium phosphate treatment or electroporation may be used for other cellular hosts.
Various methods of protein purification may be employed and such methods are
known in the art and described, for example, in Deutscher, Methods in Enzymology 182:
83-89 (1990) and Scopes, Protein Purification: Principles and Practice, 3rd Edition,
Springer, NY (1994).
The present invention also provides a process for producing a homodimer wherein
the amino acid sequence of each polypeptide of said homodimer is SEQ ID NO: 5, said
process comprising the steps of:
i) cultivating a mammalian host cell comprising a polynucleotide encoding the
polypeptide having the amino acid sequence of SEQ ID NO: 5 under conditions
such that said polypeptide sequence is expressed; and
ii) recovering from said host cell a homodimer wherein the amino acid sequence
of each polypeptide of said homodimer is SEQ ID NO: 5.
The FGF21 protein of the present invention is a homodimer when expressed in
mammalian cells. "Homodimer" as used herein, refers to two FGF21 proteins of the
present invention having the same amino acid sequence (for example SEQ ID NO: 5) that
associate through non-covalent interactions and intermolecular disulfide bonds in the Fc
portion.
The present invention provides a homodimer of a FGF21 protein, wherein the
amino acid sequence consists of a first polypeptide fused to a second polypeptide,
wherein the first polypeptide comprises an IgG4 Fc portion, wherein the Fc portion
consists of a hinge region, CH2 and CH3 constant region domains of an antibody, the
second polypeptide comprises a FGF21 protein having the amino acid sequence of SEQ
ID NO: 1, and wherein the C-terminus of the first polypeptide is fused to the N-terminus
of the second polypeptide via a linker.
Furthermore, the present invention provides a homodimer of a FGF2 1 protein,
wherein the amino acid sequence consists of a first polypeptide fused to a second
polypeptide, wherein the first polypeptide comprises an IgG4 Fc portion having the
amino acid sequence of SEQ ID NO: 14, the second polypeptide comprises a FGF21
protein having the amino acid sequence of SEQ ID NO: 1, and wherein the C-terminus of
the first polypeptide is fused to the N-terminus of the second polypeptide via a linker.
The present invention also provides a homodimer of a FGF21 protein, wherein the
amino acid sequence consists of a first polypeptide fused to a second polypeptide,
wherein the first polypeptide comprises an IgG4 Fc portion having the amino acid
sequence of SEQ ID NO: 14, the second polypeptide comprises a FGF21 protein having
the amino acid sequence of SEQ ID NO: 1, and wherein the C-terminus of the first
polypeptide is fused to the N-terminus of the second polypeptide via a linker having the
amino acid sequence of SEQ ID NO: 11.
The present invention provides a homodimer of a FGF21 protein, wherein the
amino acid sequence is
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVFTNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALFTNHY
TOKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLOFGGOVRORYLYTDD
AQQTECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDG
ALYGSLHFDPEACSFREDLKEDGYNVYOSEAHGLPLHLPGDKSPHRKPAPRGPA
RFLPLPGLPPALPEPPGILAPOPPDVGSSDPLRLVEPSOLRSPSFE (SEQ ID O: 5).
The FGF21 protein of SEQ ID NO: 5 described above includes the IgG4 Fc
portion sequence of SEQ ID NO: 14, the linker sequence of SEQ ID NO: 11 that is
identified in bold, and the FGF21 protein of SEQ ID NO: 1 that is underlined.
Furthermore, the present invention provides a homodimer of a FGF21 protein,
wherein the amino acid sequence is
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFREX1LX2EDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLP
LPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLX3SPSFX4X5 (SEQ ID NO: 15)
wherein Xi is L or D, X2 is L or K, X is R or L, X4 is L or E, and X is G or is absent.
The present invention also provides a homodimer of a FGF21 protein of SEQ ID NO: 15,
wherein the Xi is D, X2 is L or K, X is L, X4 is L, and X is G. Furthermore, the present
invention provides a homodimer of a FGF21 protein of SEQ ID NO: 15, wherein Xi is L
or D, X2 is L or K, X is R, X4 is E, and X is absent.
The present invention provides a homodimer of a FGF2 1 protein of SEQ ID NO:
15, wherein the FGF21 protein is selected from the group consisting of SEQ ID NO: 5,
SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, and SEQ ID NO: 9. The present
invention also provides a homodimer of a FGF21 protein of SEQ ID NO: 15, wherein the
FGF21 protein is selected from the group consisting of SEQ ID NO: 8 and SEQ ID NO:
9. Furthermore, the present invention provides a homodimer of a FGF21 protein of SEQ
ID NO: 15, wherein the FGF21 protein is selected from the group consisting of SEQ ID
NO: 5, SEQ ID NO: 6, and SEQ ID NO: 7. The most preferred FGF21 protein is SEQ ID
NO: 5.
The present invention also relates to polynucleotides encoding the abovedescribed
homodimer of a FGF2 1 protein of the present invention.
The present invention also provides a pharmaceutical composition comprising a
homodimer of a FGF2 1 protein of the present invention and at least one pharmaceutically
acceptable carrier, diluent, or excipient.
The present invention also provides a method of treating type 2 diabetes, obesity,
dyslipidemia, and/or metabolic syndrome in a patient comprising administering to the
patient a homodimer of a FGF21 protein of the present invention.
Furthermore, the present invention provides a homodimer of a FGF2 1 protein of
the present invention for use in therapy. Preferably, the present invention provides a
homodimer of a FGF2 1 protein of the present invention for use in the treatment of type 2
diabetes, obesity, dyslipidemia, and/or metabolic syndrome.
Furthermore, the present invention provides the use of a homodimer of a FGF21
protein of the present invention in the manufacture of a medicament for the treatment of
type 2 diabetes, obesity, dyslipidemia, and/or metabolic syndrome.
The FGF21 proteins of the present invention may be glycosylated in the Fc portion
at a highly conserved N-glycosylation site. Furthermore, the FGF21 proteins of the
present invention are a homodimer when expressed in mammalian cells. "Homodimer"
as used herein, refers to two FGF21 proteins of the present invention having the same
amino acid sequence, for example SEQ ID NO: 5, that associate through non-covalent
interactions and intermolecular disulfide bonds in the Fc portion.
Full length human wild type FGF2 1 is a 208 amino acid polypeptide containing a
27 amino acid signal peptide. Mature human wild type FGF21 comprises the full length
polypeptide without the 27 amino acid signal peptide, resulting in a 181 amino acid
polypeptide (SEQ ID NO: 2).
The changes in amino acid positions of the FGF21 proteins of the present
invention are determined from the amino acid positions in the polypeptide of mature
human wild type FGF21 (SEQ ID NO: 2) without an IgG4 Fc portion and a linker. For
example, the IgG4 Fc portion of the FGF21 protein of SEQ ID NO: 5 includes amino
acids 1 through 228, the linker of the FGF21 protein of SEQ ID NO: 5 includes amino
acids 229 through 244, and the FGF21 protein of the FGF21 protein of SEQ ID NO: 5
includes amino acids 245 through 424. Thus, a substitution described herein as "A31C"
refers to substitution of the amino acid Cys for the wild type amino acid Ala at position
3 1 of the mature human wild type FGF21.
It is important to note that a substitution of one amino acid residue in a particular
protein may affect the characteristics of the proteins as a whole, and that overall effect
may be beneficial or detrimental to the pharmacological potency and/or pharmaceutical
stability. For example, one amino acid substitution, PI 15W, increases the potency of the
FGF21 protein; however, P I 15W is also believed to contribute to the self-association that
causes aggregation. Therefore, the overall effect is detrimental to the proteins, and thus
the substitution PI 15W is not included in the FGF21 proteins of the present invention.
Another example relates the amino acid substitution R175L, which increases the potency
of the FGF21 protein. However, FGF21 proteins having the R175L substitution were
found susceptible to proteolysis, thus the overall effect was detrimental. To address the
C-terminal proteolysis observed with the FGF21 proteins of the present invention, amino
acids at positions 180 and 181 (L at position 180 and G at position 181) are substituted
with the amino acid E at position 180 and the amino acid at 181 is deleted. These
modifications substantially decrease C-terminal proteolysis, but also reduce the
pharmacological potency of the FGF21 protein by 25-fold measured in the human 293
cell-pKlotho-SRE luc assay. Surprisingly, potency is restored by reverting the amino acid
residue at position 175 (R175L) back to the wild-type R. Therefore, the overall effect of
this substitution (R175L) is detrimental to the proteins, and thus the substitution R175L is
not included in the preferred FGF21 proteins of the present invention.
Certain FGF2 1 proteins of the present invention are potent, biologically active
proteins as demonstrated for SEQ ID NO:5 in Examples 2 and 3. The preferred FGF21
proteins of the present invention contain amino acid substitutions that together not only
improve potency, but also are compatible with other amino acid changes that, in turn,
may provide for improved stability characteristics and increased in vivo stability. The
amino acid substitutions in the preferred FGF21 proteins of the present invention that
improve potency include D127K, S167R, and G174L (see Examples 2 and 3).
Exposure of a concentrated protein solution of human wild type FGF21 to a
pharmaceutical preservative, such as m-cresol, increases the propensity of the protein to
form aggregates. Structural stabilization through the introduction of an additional
disulfide bond improves the preservative compatibility as well as the thermal stability of
human wild type FGF21. The FGF21 proteins of the present invention incorporate the
amino acid substitutions A3 1C and G43C that greatly improve thermal stability and
preservative compatibility without compromising biological activity. High potency
FGF21 proteins that also include the A31C/G43C substitutions have been described
previously. Those reported proteins display significantly improved preservative
compatibility relative to wild type FGF2 1, but they are still prone to aggregation in the
presence of preservative. This protein aggregation increases the risk of immunogenicity,
thereby reducing the acceptability of the proteins as a therapeutic protein.
Fusion of FGF21 proteins to the Fc portion also makes self-association more
prominent. This behavior may be due to the homodimeric structure of the Fc fusions that
could lead to avidity, stabilizing self interaction and aggregation.
The preferred proteins of the present invention include the amino acid
substitutions L98D and L100K, which surprisingly result in significantly lower high
molecular weight aggregate formation at high concentrations. Advantageously, the amino
acid substitutions L98D and L100K do not decrease the potency of the proteins, but they
do minimize the detrimental aggregation problem.
A preferred commercial expression system for manufacture of the FGF21 proteins
of the present invention is the mammalian CHO-K1 cell line. However, the mammalian
cell lines CHO-K1 and HEK293 may cause post-translational modifications to mature
human wild type FGF21 through sulfation of the tyrosine side chain at position 179.
Sulfation of tyrosine residues at positions 179 and 180 (if present) decreases potency and
is an undesirable source of product heterogeneity. Thus, when an FGF21 protein having
Tyr at position 179 and/or 180 is expressed from CHO-Kl or HEK293 cell lines, some
proportion of the expressed proteins may be sulfated at position 179, others may be
sulfated at position 180, while others may be sulfated at both positions and some at
neither position. This leads to a heterogeneous and unpredictable protein population with
decreased potency.
The preferred FGF21 proteins of the present invention include an amino acid
substitution that has resolved this detrimental sulfation. Thus, the amino acid substitution
Y179F has been incorporated into the proteins. Y179F eliminates the sulfation resulting
from production in CHO-Kl and HEK293 cells. Moreover, the amino acid substitution
Y179F is compatible with the other favored amino acid substitutions of the present
invention, and is determined to be a neutral change with regard to potency.
Human wild type FGF2 1 is susceptible to proteolytic degradation in vivo. A
major proteolytic fragment recovered from sera after intravenous or subcutaneous
injection of mice or cynomolgus monkeys with wild type FGF21 is the fragment that
terminates at position 171. The FGF21 fragment spanning residues 1 to 171 has been
determined to be ~ 100-fold less potent in in vitro potency assays. Thus, eliminating this
proteolytic cleavage site may improve drug efficacy by increasing exposure to active
drug. The amino acid substitution G170E has been shown to significantly slow cleavage
in mouse and virtually eliminate proteolysis at the 171 position when measured after 24
hours in cynomolgus monkeys. The G170E substitution does not impact potency and is
compatible with the desired physicochemical stability profile. Therefore, the amino acid
substitution G170E is incorporated into the FGF21 proteins of the present invention.
Human wild type FGF21 is also susceptible to a carboxypeptidase produced in
CHO-Kl manufacture, and the amino acid substitution A180E and amino acid deletion at
position 181 slows this processing, thereby reducing heterogeneity of the length of the
protein expressed (i.e., heterogeneity in the number of amino acid residues in the mature
protein expressed by the cell line). Although the amino acid substitution A180E and the
amino acid deletion at position 181 do not eliminate C-terminal proteolysis in mammalian
cell expression, it is quite effective at slowing proteolysis while maintaining potency in
the context of other desired amino acid substitutions found in the FGF21 proteins of the
present invention. In view of this advantageous characteristic, the amino acid substitution
A180E and the amino acid deletion at position 181 are incorporated into the preferred
FGF21 proteins of the present invention.
The FGF21 proteins of the present invention are fused via a linker to the Fc
portion of an immunoglobulin. The Fc portion used for the FGF2 1 proteins of the present
invention is derived from an IgG4 Fc portion. It is even more preferable that the FGF2 1
proteins of the present invention contain an Fc portion which is derived from human
IgG4, but comprises one or more substitutions compared to the wild type human
sequence. As used herein, the Fc portion of an immunoglobulin has the meaning
commonly given to the term in the field of immunology. Specifically, this term refers to
an antibody fragment which does not contain the two antigen binding regions (the Fab
fragments) from the antibody. The Fc portion consists of a hinge region, CH2 and CH3
constant region domains of an antibody.
It is well known in the art that mammalian expression of antibodies results in
glycosylation. Typically, glycosylation occurs in the Fc portion of the antibody at a
highly conserved N-glycosylation site. N-glycans typically attach to asparagine.
Thus, the FGF21 proteins of the present invention are derived from the human
IgG4 Fc region of an immunoglobulin fused to a FGF21 protein of the present invention.
Preferably, the Fc portion of the FGF21 protein comprises the sequence of SEQ ID NO:
14:
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLG (SEQ ID NO: 14)
The N-terminal amino acid of a FGF21 protein of the present invention is fused to
the C-terminus of each heavy chain of the Fc portion via a glycine-rich linker (G-rich),
designated by L, with the number immediately preceding the L referring to the number of
repeating linker units separating the FGF21 protein from the Fc portion. A linker unit is
defined as a Gly-Gly-Gly-Gly-Ser sequence (SEQ ID NO: 10). The linker optionally
contains an Ala linked to the final Ser if multiple linker repeats are used.
Fc portion of the FGF21 proteins of the present invention are preferably fused
together via 1, 2, or 3 repeats of the G-rich peptide linker, -Gly-Gly-Gly-Gly-Ser- (SEQ
ID NO: 10), designated as 1L. Additional G-rich linkers of the present invention
comprise the sequences -Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Ala (SEQ ID NO:
12), designated 2L and -Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-
Ser-Ala (SEQ ID NO: 11), designated 3L. The most preferred glycine-rich linker of the
present invention is linker 3L, -Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-Gly-Ser-Gly-Gly-Gly-
Gly-Ser-Ala (SEQ ID NO: 11).
It is understood that the IgG4 Fc is comprised of the constant region from both
heavy chains of an IgG4 antibody. Thus, the FGF21 proteins of the present invention are
comprised of an IgG4 Fc portion fused with two FGF21 proteins having the same amino
acid sequence via G-rich linkers to each C-terminus of each IgG4 Fc portion polypeptide.
The pharmaceutical compositions of the FGF21 proteins of the present invention
may be administered by any means known in the art that achieve the generally intended
purpose to treat type 2 diabetes, obesity, dyslipidemia, and/or metabolic syndrome. The
preferred route of administration is parenteral. The dosage administered will be
dependent upon the age, health, and weight of the recipient, kind of concurrent treatment,
if any, frequency of treatment, and the nature of the effect desired. Typical dosage levels
can be optimized using standard clinical techniques and will be dependent on the mode of
administration and the condition of the patient and can be determined by a person having
ordinary skill in the art.
The FGF21 proteins of the present invention are formulated according to known
methods to prepare pharmaceutically useful compositions. A desired formulation is a
stable lyophilized product that is reconstituted with an appropriate diluent or an aqueous
solution of high purity with optional pharmaceutically acceptable carriers, preservatives,
excipients or stabilizers [Remington, The Science and Practice of Pharmacy, 19th edition,
Gennaro, ed., Mack Publishing Co., Easton, PA 1995].
The FGF21 proteins of the present invention may be formulated with a
pharmaceutically acceptable buffer, and the pH adjusted to provide acceptable stability,
and a pH acceptable for administration. Moreover, the FGF21 compositions of the
present invention may be placed into a container such as a vial, a cartridge, a pen delivery
device, a syringe, intravenous administration tubing or an intravenous administration bag.
The term "dyslipidemia" means a disorder of lipoprotein metabolism, including
lipoprotein overproduction or deficiency. Dyslipidemia may be manifested by elevation
of the total cholesterol, low-density lipoprotein (LDL) cholesterol and the triglyceride
concentrations, and/or a decrease in high-density lipoprotein (HDL) cholesterol
concentration in the blood.
The term "metabolic syndrome" is characterized by a group of metabolic risk factors
in one person. They include: abdominal fat—in most men, a 40-inch waist or greater; high
blood sugar—at least 110 milligrams per deciliter (mg/dl) after fasting; high triglycerides—at
least 150 mg/dL in the bloodstream; low HDL—less than 40 mg/dl; and/or, blood pressure of
130/85 or higher.
The term "obesity" is defined as a condition in which there is an excess of
subcutaneous fat in proportion to lean body mass (Stedman's Medical Dictionary 28th
edition, 2006, Lippincott Williams & Wilkins).
A "patient" is a mammal, preferably a human.
The term "treating" (or "treat" or "treatment") means slowing, reducing, or
reversing the progression or severity of an existing symptom, disorder, condition, or
disease.
The term "therapeutically effective amount" refers to the amount or dose of a
protein of the present invention, which, upon single or multiple dose administration to a
patient, provides the desired treatment.
The term "type 2 diabetes" is characterized by excess glucose production in spite of
the availability of insulin, and circulating glucose levels remain excessively high as a result
of inadequate glucose clearance.
The present invention may be practiced by referencing the following examples.
However, this is not to be interpreted as limiting the scope of the present invention.
Furthermore, the FGF21 proteins of the present invention described and exemplified in
the examples are expressed in mammalian cells, and therefore are a homodimer.
Example 1
Expression of FGF21 proteins in CHOK1SV Cells
The FGF21 proteins of the present invention are produced in a mammalian cell
expression system using CHOK1SV cells. Genes coding for the FGF21 proteins of the
present invention are sub-cloned into the Glutamine Synthetase (GS)-containing
expression plasmid backbones (pEE12.4-based plasmids). The cDNA sequence encoding
the FGF21 proteins of the present invention is fused in frame with the coding sequence of
preferred signal peptide sequences to enhance secretion of the desired product into the
tissue culture medium. The preferred signal peptide sequences are the polypeptides as
shown in the amino acid sequences SEQ ID NO: 3 and SEQ ID NO: 4.
The expression is driven by the viral cytomegalovirus (CMV) promoter.
CHOK1SV cells are stably transfected using electroporation and the appropriate amount
of recombinant expression plasmid, and the transfected cells are maintained in suspension
culture, at the adequate cell density. Selection of the transfected cells is accomplished by
growth in methionine sulfoximine (MSX)-containing serum-free medium and incubated
at 35-37 °C and 5-7 % C0 2.
Clonally-derived cell lines are measured or determined by use of a flow
cytometer. The expression of a FGF21 protein in mammalian cells generally yields the
natural N-terminal sequence, ESKY, i.e. without a methionine residue at the N-terminus,
such as the FGF21 protein shown by the amino acid sequence of SEQ ID NO: 5.
FGF21 proteins secreted into the media from the CHO cells may be purified by
Protein A affinity chromatography followed by preparative size exclusion
chromatography following standard chromatographic techniques. Briefly, FGF21
proteins from harvested media are captured onto Mab Select Protein A (GE, Piscataway,
NJ) with PBS pH 7.4 running buffer; briefly washed with running buffer to remove nonspecifically
bound material; and eluted with 10 mM citrate pH 3.0. Fractions containing
FGF21 proteins are pooled and pH is neutralized by adding 1/10 volume of 1M Tris pH
8.0. The neutralized pool is concentrated and loaded onto a Superdex 200 size exclusion
chromatography column (GE, Piscataway, NJ) with PBS pH 7.4 mobile phase. Fractions
containing monomeric FGF2 1 protein (a covalently linked homodimer) are pooled,
concentrated, and stored.
Alternatively, the cell free media containing FGF21 proteins may be heated to 50-
60 °C for up to two hours, cooled, treated with detergent (Triton X-100) for viral
inactivation, applied to a Mab Select Protein A (GE Healthcare) column, and washed
successively with pH 7 Tris buffered solution with and without sodium chloride to
remove non-specifically bound materials. The FGF21 protein is eluted from the column
using 20 mM citrate pH 3 and held at pH 3.4 to 3.7 for up to two hours for viral
inactivation. The solution is adjusted to pH 4.8 to 5.2 by addition of Tris buffer and
sodium chloride and mixed for at least 15 minutes. Precipitates that form are removed by
depth filtration (Millipore). The FGF21 protein is further purified by cation exchange
chromatography using resins such as Poros HS 50 (Life Technologies) or SP Sepharose
HP (GE Healthcare). The cation exchange column is eluted with sodium chloride in a pH
5 sodium acetate buffered solution. The FGF protein may be further purified by
hydrophobic interaction chromatography on Phenyl Sepharose HP (GE Healthcare) by
adjusting the pH from 7 to 8 using a Tris buffer, addition of sodium sulfate and
application to the column followed by elution with a reversed concentration gradient of
sodium sulfate. Purified FGF21 protein can be passed through a viral retention filter such
as Planova 20N (Asahi Kasei Medical) followed by concentration/diafiltration into 10
mM citrate, 150 mM NaCl pH 7 using tangential flow ultrafiltration on a regenerated
cellulose membrane (Millipore).
Example 2
3T3-Ll-pKlotho Fibroblast Glucose Uptake Assay
3T3-Ll-pKlotho fibroblasts are generated from 3T3-L1 fibroblasts by retroviral
transduction of a CMV-driven mammalian expression vector containing the coding
sequence of wild type mouse pKlotho and a blasticidin resistance marker. Blasticidinresistant
cells are selected after growth for 14 days in the presence of 15 blasticidin,
and pKlotho protein expression is verified by immunoblot with an anti-pKlotho antibody.
The 3T3-Ll-pKlotho fibroblasts are maintained in Dulbecco's Modified Eagle Medium
(DMEM) with 10 % calf serum, and 15 blasticidin until plated for experimental use.
For glucose uptake, 3T3-Ll-pKlotho fibroblasts are plated at 20,000 cells/well in
96-well plates and incubated for 48 hours in DMEM with 10 % calf serum. The cells are
incubated for 3 hours in DMEM with 0.1% bovine serum albumin (BSA) with or without
an FGF2 1 protein of interest, followed by 1 hour incubation in Krebs-Ringer phosphate
(KRP) buffer (15 mM Hepes, pH 7.4, 118 mM NaCl, 4.8 mM KC1, 1.2 mM MgS0 4, 1.3
mM CaCl2, 1.2 mM KH2P0 4, 0.1 % BSA) containing 100 2-deoxy-D-( 14C) glucose
with or without an FGF21 protein. Non-specific binding is determined by incubation of
select wells in Krebs-Ringer bicarbonate/Hepes (KRBH) buffer containing 1mM 2-
deoxy-D-( 14C) glucose. The reaction is terminated by addition of 20 cytochalasin B
to the cells and glucose uptake is measured using a liquid scintillation counter.
Following the protocol essentially as described above, the in vitro potency (EC50)
of the homodimer of the FGF21 protein of SEQ ID NO: 5 in the 3T3-Ll-pKlotho
fibroblast glucose uptake assay is determined to be 0.070 nM.
Example 3
Human 293 cell-BKlotho-SRE luc Assay
Construction of 293-pKlotho-SRE luc reporter cells:
HEK-293 cells (human embryonic kidney cells) are cultured at 37 °C, 5 % CO2 in
growth medium (GM) containing 10 % fetal bovine serum (FBS) in Dulbecco's modified
Eagle's medium. Cells are cotransfected with a plasmid containing a CMV promoter
driven human pKlotho expression cassette and a plasmid containing a Serum Response
Element (SRE) driven luciferase expression cassette. The pKlotho expression plasmid
also contains an SV40 promoter driven neomycin phosphotransferase expression cassette
to confer resistance to the aminoglycoside antibiotic G418. Transfected HEK-293 cells
are selected with 600 g/mL of G418 to select for cells where the transfected plasmids
have been integrated into the genome. Selected cells are cloned by dilution and tested for
an increase in luciferase production at 24 hours post addition of FGF21. The clone
demonstrating the largest FGF2 1 dependant increase in luciferase is chosen as the cell
line used to measure relative FGF2 1 proteins activity.
293-pKlotho-SRE luc FGF21 activity assay:
293-pKlotho-SRE luc cells are rinsed and placed into CD 293 suspension culture
media (Invitrogen). Cells are grown in suspension overnight at 37 °C, 6 % CO2, 125
rpm. Cells are counted, pelleted by centrifugation, and re-suspended in CD 293 media
containing 0.1% BSA. Cells are placed in white 96 well plates at 25,000 cells per well.
A four-fold serial dilution in CD 293/0.1 % BSA is prepared for each FGF21 protein to
generate eight dilutions with final concentrations from 100 nM to 0.006 nM. Dilutions
are added to cells in triplicate and incubated for 16-20 hours at 37 °C, 5 % CO2.
Luciferase level is determined by the addition of an equal volume of OneGlo™ luciferase
substrate (Promega) and measuring relative luminescence. Data is analyzed using a four
parameter logistic model (XLfit version 5.1) to fit the curves and determine EC50.
Following the protocol essentially as described above, the average in vitro potency
(EC 0) of the homodimer of the FGF21 protein of SEQ ID NO: 5 in the human 293 cellpKlotho-
SRE luc assay is determined to be 0.51 nM.
Example 4
Physical Stability
R175 and El 80 Expression Heterogeneity
Production of a homogeneous protein product is desirable since it better ensures a
consistent and well-characterized product. To assess product heterogeneity, a 10
aliquot of a sample is mixed with 90 of DPBS. The sample is analyzed by liquid
chromatography-mass spectrometry (LC-MS), using the following conditions: the mobile
phase A is 0.05 % TFA, the mobile phase B is 0.04 % TFA in acetonitrile, the column is a
PLRPS 2.1 X 50 mm column, the injection volume is 15 .
Table 1 : Gradient Conditions for Liquid Chromatographic Separation
A Waters Micromass LCT Premier™ mass spectrometer is set up to a mass range
between 400 to 1990 amu, polarity ES+, capillary 3000, sample cone 40 V, aperture 1 is
25 V, the source temperature is 105 °C, cone gas flow is 50 L/hour, desolvation
temperature is 150 °C, and the desolvation gas flow is 600 L/hour.
Table 2 : LC/MS Characterization of FGF21 Proteins
Table 2 reports the resulting heterogeneity in each FGF21 protein as determined
by LC/MS method. The product 1-425 represents the full length FGF21 protein
containing the IgG4 Fc portion, linker and FGF2 1 protein for the FGF2 1 protein of SEQ
ID NO: 8 and the FGF2 1 protein of SEQ ID NO: 9. The FGF2 1 protein of SEQ ID NO: 8
and the FGF21 protein of SEQ ID NO: 9 differ only at position 100 with the FGF21
protein of SEQ ID NO: 8 containing the wild type residue leucine and the FGF21 protein
of SEQ ID NO: 9 containing the amino acid residue lysine (L100K) and both proteins
have identical C-termini. Both of these proteins are susceptible to C-terminal truncations,
especially removal of the amino acid residue glycine at position 181. As shown in Table
2, less than 50% of the purified product for the homodimer of the FGF21 protein of SEQ
ID NO: 8 and the homodimer of the FGF21 protein of SEQ ID NO: 9 is the intended fulllength
1-425; the 1-424 fragment makes up the largest portion of the purified product. In
addition, minor amounts of products 1-422, 1-41 1, and 1-379 are also detected.
The FGF21 protein of SEQ ID NO: 5 has the amino acid residue at 181 deleted in
the genetic construct and amino acid residue 180 has been substituted to glutamic acid
(E). These changes protect the C-terminus from degradation during CHO expression,
resulting in 100 % homogeneous purified 1-424 product.
Example 5
Physical Stability
Self-Association at High Concentration
Protein aggregation and self-association is undesired since it could potentially
exacerbate unwanted effects such as triggering an immune response. Thus, maintaining
the protein in a monomeric state (a covalently linked homodimer) is preferred. To test for
the propensity of FGF21 proteins to self-associate, proteins were dialyzed into the buffers
listed in Table 3 and analyzed by size exclusion chromatography (SEC) to determine the
% high molecular weight (% HMW) of a 1.0 mg/mL solution. % HMW is an indicator of
protein aggregation and self-association.
The SEC separation method is performed on a Tosoh Bioscience 3000SWXL, 5
micron column with dimensions 30 cm x 0.78 cm. Mobile phase is 0.05 M sodium
phosphate, 175 mMNaCl, pH 7 at a flow rate of 0.5 mL/minute. 1.0 mg/mL samples are
applied as 10 mcL injections and monitored at an absorbance wavelength of 214 nm,
whereas 75 mg/mL samples are applied as 1 mcL injections and monitored at 280 nm.
Table 3 : Self-Association
Table 3 illustrates 4-5 % HMW for the homodimer of the FGF21 protein of SEQ
ID NO: 8 and <1% HMW for the homodimer of the FGF21 protein of SEQ ID NO: 9 and
the homodimer of the FGF21 protein of SEQ ID NO: 5 at 1.0 mg/mL for all buffer
compositions. Samples were then concentrated to 75 mg/mL to simulate a high
concentration formulation and analyzed again by SEC to determine the % HMW. The
homodimer of the FGF21 protein of SEQ ID NO: 8 variant contained 13.7-21.9 % HMW
at 75 mg/niL, whereas the homodimer of the FGF21 protein of SEQ ID NO: 9 contained
only 2.2-3.5 %. Since the only difference between the FGF2 1 protein of SEQ ID NO: 8
and the FGF21 protein of SEQ ID NO: 9 is a substitution at position 100 (L100L versus
L100K), this data demonstrates that L100K reduces HMW formation.
The FGF21 protein of SEQ ID NO: 5 also contains L100K in addition to other
changes, and the lower % HMW is also observed in this homodimer protein.
Example 6
Physical Stability
L100K Substitution and % High Molecular Weight
Physical stability of FGF21 proteins is determined as follows. Proteins are
dialyzed and prepared at 1-2 mg/mL in 10 mM Citrate pH7, 150 mMNaCl and analyzed
by SEC to determine the % HMW (Table 3 : "Initial").
The SEC separation method is performed on a Tosoh Bioscience 3000SWXL, 5
micron column with dimensions 30 cm x 0.78 cm. Mobile phase is 0.05 M sodium
phosphate, 175 mMNaCl, pH 7 at a flow rate of 0.5 mL/minute. Initial low
concentration samples are applied as 10 mcL injections and monitored at an absorbance
wavelength of 214 nm, whereas the 50 mg/mL samples are applied as 1mcL injections
and monitored at 280 nm.
Next, proteins are concentrated to 50 mg/mL and analyzed again (t=0). The %
HMW for the homodimer of the FGF21 protein of SEQ ID NO: 8 increased from 4.5% to
9.3% upon concentration. The % HMW for the homodimer of the FGF21 protein of SEQ
ID NO: 9 increased from 0.9%> to 1.4% upon concentration. The % HMW for the
homodimer of the FGF21 protein of SEQ ID NO: 5 increased from 0.4% to 1.4% upon
concentration. Thus, both the homodimer of the FGF21 protein of SEQ ID NO: 9 and the
homodimer of the FGF21 protein of SEQ ID NO:5 have lower initial % HMW and lower
% HMW when proteins are formulated at 50 mg/mL than the homodimer of the FGF21
protein of SEQ ID NO: 8. These data demonstrate the importance of the L100K mutation
that is present in the FGF21 protein of SEQ ID NO:9 and the FGF21 protein of SEQ ID
NO: 5, but not present in the FGF2 1 protein of SEQ ID NO: 8.
The 50 mg/niL formulations are incubated for 4 weeks at 4 °C, 25 °C, and 40 °C
to assess longer-term stability under stress conditions. As shown in Table 4, the % HMW
is determined again at 4 weeks time (t=4 weeks). The % HMW for the homodimer of the
FGF21 protein of SEQ ID NO: 8 increased from 9.3% to 16.0% at 40 °C. The % HMW
for the homodimer of the FGF21 protein of SEQ ID NO: 9 increased from 1.4% to 5.5%
at 40 °C. The % HMW for the homodimer of the FGF21 protein of SEQ ID NO: 5
increased from 0.4% to 5.4% at 40 °C. After 4 weeks at 25 °C, levels of %HMW were
only 3.3% for the homodimer of the FGF21 protein of SEQ ID NO: 9 and the homodimer
of the FGF21 protein of SEQ ID NO: 5, whereas they were 13.8% for the homodimer of
the FGF21 protein of SEQ ID NO: 8. These data demonstrate the beneficial impact of
including the L100K mutation present in the FGF21 protein of SEQ ID NO: 9 and FGF21
protein of SEQ ID NO: 5.
Table 4 :%High Molecular Weight
Example 7
Physical Stability
Self-Association
Purified FGF21 protein of SEQ ID NO: 7 (which is the FGF21 protein of SEQ ID
NO: 5 having D98L) and purified FGF21 protein of SEQ ID NO: 6 (which is the FGF21
protein of SEQ ID NO: 5 having K100L) were dialyzed into 10 mM Citrate, 50 mM
NaCl, pH6 buffer and concentrations are determined to be 12.9 mg/mL, 1.0 mg/mL, and
0.6 mg/mL, respectively. Each recovered sample from dialysis is analyzed by SEC to
determine the % HMW (Table 5). The % HMW was < 1% for all recovered dialysates.
Next, samples are concentrated to 65-87 mg/mL using a 10,000 molecular weight cut-off,
4mL Millipore spin concentrator. The concentrations for each sample are shown in Table
5. After concentration, the % HMW is determined again by SEC using the concentrated
protein.
As shown in Table 5, the % HMW for the homodimer of the FGF21 protein of
SEQ ID NO: 5 increased to 2.3 % indicating a low level of self-association that occurred
at higher concentrations. In contrast, the % HMW for the homodimer of the FGF21
protein of SEQ ID NO: 7 (which is the FGF2 1 protein of SEQ ID NO: 5 having D98L)
and the homodimer of the FGF21 protein of SEQ ID NO: 6 (which is the FGF21 protein
of SEQ ID NO: 5 having K100L) increased to levels of 8.0 % and 14.2 %, respectively.
These data demonstrate a higher propensity for undesirable self-association when wild
type L98 or LI00 is included in the sequence. Thus, both L98D and L100K substitutions
contribute to a decrease the self-association of the FGF21 protein of SEQ ID NO: 5.
Furthermore, it is concluded that the presence of L100K in the absence of L98D (i.e. the
FGF21 protein of SEQ ID NO: 7) is insufficient to fully minimize self-association.
Conversely, it is concluded that the presence of L98D in the absence of L100K (i.e. the
FGF21 protein of SEQ ID NO: 6) is insufficient to fully minimize self-association. Thus,
the maximum effect on reducing self association requires both L98D and L100K together.
Upon dilution of concentrated proteins to 1 mg/mL, the % HMW decreases
demonstrating that the self-association is reversible. Dilution of the homodimer of the
FGF21 protein of SEQ ID NO: 6 (which is the FGF21 protein of SEQ ID NO: 5 having
K100L) to 1 mg/mL results in the % HMW decreasing from 14.2 % to 2.0 %. Dilution of
the homodimer of the FGF21 protein of SEQ ID NO: 7 (which is the FGF21 protein of
SEQ ID NO: 5 having D98L) to 1 mg/mL results in the % HMW decreasing from 8.0 %
to 1.3 %. When L98D and L100K are present together in the homodimer of the FGF21
protein of SEQ ID NO: 5, the % HMW decreases to 0.88% upon dilution to 1 mg/mL,
again demonstrating the more beneficial behavior when L98D and L100K are combined.
Table 5 : Self-Association
Example 8
Glucose Lowering in Obfob Mouse Model
Male ob/ob mice and age-matched ob/m (lean) controls are 7 weeks of age upon
arrival and 8-9 weeks of age at initiation of treatment. Upon arrival, all mice are single
housed and allowed to acclimate for 1-2 weeks before the start of treatment. The mice
are fed Purina Rodent Chow 5015 and given house water from an auto-water apparatus ad
libitum. The mice are housed in 12-hour light/dark cycle with ambient temperature set at
75 °F. One to two days prior to initiation of treatment, blood samples are collected via
tail bleed. Blood glucose levels are measured using an Accu-Check Avivia blood glucose
meter (Roche) and serum samples are collected for the assay of insulin using the Meso
Scale mouse/rat insulin assay kit. On the day of treatment initiation (day 0), the mice are
sorted into groups based on the pretreatment body weight, blood glucose, and serum
insulin (BRAT sorting software). On day 0 and day 3, mice are dosed SQ with 0.1 to 30
nmol/kg of the homodimer of the FGF21 protein of SEQ ID NO: 5, in a volume of 10
ml/kg. Dosing vehicle is sterile PBS (HyClone DPBS/Modified -Calcium -Magnesium)
containing 0.03% mouse serum albumin (MSA; Sigma A3139). Blood glucose is
measured daily for 7 days and the AUC is determined. ED 0 calculations for the glucose
lowering are based on the AUC. Liver homogenates are collected at the time of sacrifice
and liver triglycerides are measured on the Hitachi Modular P clinical analyzer.
On day 7, vehicle treated mice were hyperglycemic with mean blood glucose
levels measured at 387 ± 63.0 mg/dl (mean ± SEM), while ob/m lean control mice had
blood glucose levels of 162 ± 9.0 mg/dl (mean ± SEM). The homodimer of the FGF21
protein of SEQ ID NO: 5 lowered blood glucose to levels comparable to the ob/m lean
controls. The ED 0 of the homodimer of the FGF21 protein of SEQ ID NO: 5 was 2.796
nmol/kg (95 % confidence interval = 1.1 - 7.0).
Sequences
SEP ID NO; 1 - FGF21 protein
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQL
KALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNVYQSE
AHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLR
LVEPSQLRSPSFE
SEP ID NO; 2 - Wild Type FGF21 (Homo Sapiens)
HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQL
KALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSE
AHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLS
MVGPSQGRSPSYAS
SEP ID NP; 3 - Human transferrin (hTrf) Signal Peptide
MRLAVGALLVCAVLGLCLA
SEP ID NP; 4 - Human fibroblast growth factor binding protein-1 hFGFP-1
Signal Peptide
MKICSLTLLSFLLLAAQVLLVEG
SEP ID NP; 5 - FGF21 protein
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPL
PGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLRSPSFE
SEP ID NO; 6 - FGF21 protein
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFREDLLEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPL
PGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLRSPSFE
SEP ID NO; 7 - FGF21 protein
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFRELLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPL
PGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLRSPSFE
SEP ID NO; 8 - FGF21 protein
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFREDLLEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPL
PGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLLSPSFLG
SEP ID NO; 9 - FGF21 protein
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFREDLKEDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPL
PGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLLSPSFLG
SEP ID NP; 10 - Linker L
GGGGS
SEP ID NP; 11 - Linker (3D
GGGGSGGGGSGGGGSA
SEP ID NO; 12 - Linker 2L
GGGGSGGGGSA
SEP ID NO; 13 - DNA of the FGF21 protein
GAGTCCAAATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGGCCGCCG
GGGGACCATCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTCTCATGATC
TCCCGGACCCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCAGGAAGACC
CCGAGGTCCAGTTCAACTGGTACGTGGATGGCGTGGAGGTGCATAATGCCAA
GACAAAGCCGCGGGAGGAGCAGTTCAACAGCACGTACCGTGTGGTCAGCGTC
CTCACCGTCCTGCACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGG
TCTCCAACAAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAA
AGGGCAGCCCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAG
ATGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCA
GCGACATCGCCGTGGAGTGGGAAAGCAATGGGCAGCCGGAGAACAACTACA
AGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGG
CTAACCGTGGACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCG
TGATGCATGAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCT
CTGGGTGGTGGTGGTGGCTCCGGAGGCGGCGGCTCTGGTGGCGGTGGCAGCG
CTCACCCCATCCCTGACTCCAGTCCTCTCCTGCAATTCGGGGGCCAAGTCCGG
CAGCGGTACCTGTACACCGACGACGCCCAGCAGACCGAGTGCCACCTGGAAA
TCCGGGAGGACGGCACCGTGGGCTGTGCCGCCGACCAGTCCCCTGAGTCCCT
GCTGCAGCTGAAGGCCCTGAAGCCTGGCGTGATCCAGATCCTGGGCGTGAAA
ACCTCCCGGTTCCTGTGCCAGAGGCCTGATGGCGCCCTGTACGGCTCCCTGCA
CTTCGACCCTGAGGCCTGCTCCTTCCGGGAGGACCTGAAGGAAGATGGCTAC
AACGTGTACCAGTCCGAGGCTCACGGCCTGCCTCTGCATCTGCCTGGCGACAA
GTCCCCCCACCGGAAGCCTGCTCCTAGGGGCCCTGCCAGATTCCTGCCACTGC
CTGGCCTGCCTCCAGCTCTGCCTGAGCCTCCTGGCATCCTGGCCCCTCAGCCT
CCAGACGTGGGCTCCTCCGACCCTCTGCGGCTGGTCGAGCCTTCCCAGCTGCG
GAGCCCTAGCTTCGAG
SEP ID NO; 14 - Fc portion
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRWSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLG
SEP ID NO; 15 - Consensus FGF21 protein
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQ
FNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK
GLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWE
SNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHY
TQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDSSPLLQFGGQVRQRYLYTDDAQQ
TECHLEIREDGTVGCAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYG
SLHFDPEACSFREX1LX2EDGYNVYQSEAHGLPLHLPGDKSPHRKPAPRGPARFLP
LPGLPPALPEPPGILAPQPPDVGSSDPLRLVEPSQLX3SPSFX4X5
Xi is L or D
2 is L or K
X 3 is R or L
X4 is L or E
is G or is absent
We Claim:
1. A homodimer of a fibroblast growth factor
2 1 (FGF21) protein, wherein the amino acid sequence consists of a first
polypeptide fused to a second polypeptide, wherein the first polypeptide
comprises an IgG4 Fc portion, the second polypeptide comprises a FGF21 protein
having the amino acid sequence of SEQ ID NO: 1, and wherein the C-terminus of
the first polypeptide is fused to the N-terminus of the second polypeptide via a
linker.
The homodimer of Claim 1, wherein the
amino acid sequence of the IgG4 Fc portion is SEQ ID NO: 14.
The homodimer of either Claim 1 or Claim
2, wherein the amino acid sequence of the linker is SEQ ID NO: 11.
The homodimer of any one of Claims 1 to 3,
wherein the amino acid sequence is
ESKYGPPCPPCPAPEAAGGPSVFLFPPKPKDTLMISRTPEVTCVWDVSQE
DPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGK
EYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCL
VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQ
EGNVFSCSVMHEALHNHYTQKSLSLSLGGGGGSGGGGSGGGGSAHPIPDS
SPLLQFGGQVRQRYLYTDDAQQTECHLEIREDGTVGCAADQSPESLLQLK
ALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFREDLKEDGYNV
YQSEAHGLPLHLPGDKSPHRKPAPRGPARFLPLPGLPPALPEPPGILAPQPP
DVGSSDPLRLVEPSQLRSPSFE (SEQ ID NO: 5).
5. The homodimer of any one of Claims 1 to 4,
wherein the IgG4 Fc portion of the protein is glycosylated.
6. A DNA molecule encoding a polypeptide, wherein the amino acid sequence of the
polypeptide is SEQ ID NO: 5.
7. A mammalian host cell transformed with a DNA molecule of Claim 6, which cell
is capable of expressing a homodimer wherein the amino acid sequence of each
polypeptide of said homodimer is SEQ ID NO: 5.
8. A process for producing a homodimer wherein the amino acid sequence of each
polypeptide of said homodimer is SEQ ID NO: 5, said process comprising the
steps of:
i) cultivating a mammalian host cell comprising a polynucleotide encoding
the polypeptide having the amino acid sequence of SEQ ID NO: 5 under
conditions such that said polypeptide sequence is expressed; and
ii) recovering from said host cell a homodimer wherein the amino acid
sequence of each polypeptide is SEQ ID NO: 5.
9. A homodimer produced by the process of Claim 8.
10. A pharmaceutical composition comprising
the homodimer of any one of Claims 1to 5 or Claim 9, and at least one
pharmaceutically acceptable carrier, diluent, or excipient.
11. A method for treating type 2 diabetes,
obesity, dyslipidemia, and/or metabolic syndrome, comprising administering a
homodimer of any one of Claims 1 to 5 or Claim 9 to a patient in need thereof.
12. The homodimer of any one of Claims 1 to 5
or Claim 9 for use in therapy.
13. The homodimer of any one of Claims 1 to 5
or Claim 9 for use in the treatment of type 2 diabetes, obesity, dyslipidemia,
and/or metabolic syndrome.