Abstract: The present invention relates in general to a process of production of recombinant heterologous proteins in E. coli expression system using E. coli Yeast fungi or mammalian methionine amino peptidase (MAP) protein as a fusion tag. Further the invention relates to the fusion proteins of MAP protein.
1. A process for the preparation of heterologous protein in bacterial cells comprising the steps of: a) Preparing a fusion DNA comprising a DNA fragment encoding MAP protein and a DNA fragment fused in frame encoding the heterologous protein of interest, b) Insertion of the fusion DNA of step a in a vector, c) Cloning of the vector comprising the fusion DNA of step a, d) Expressing the fusion protein in bacterial cells and extraction thereof from bacterial cells, e) Obtaining protein of interest from fusion protein, f) Optionally purifying the protein of interest.
2. The process of claim 1, wherein the heterologous protein of interest is selected from the group comprising of monoclonal antibodies, cytokines, growth stimulating factors, hormones, interferons, interleukins and enzymes.
3. The process of claim 1, wherein the heterologous protein of interest is selected from the group comprising of ranibizumab, parathyroid hormone (1-34), parathyroid hormone ( 1 - 84), reteplase, interferon, IL-2, IL-3, IL-4, IL-5, IL-6, IL-1 1 and GCSF.
4. The process of claim 1, wherein the bacterial cells are E. coli cells.
5. The process of claim 1, wherein the fusion protein is purified using one or more chromatographic purification technique selected from the group consisting of affinity chromatography, metal affinity chromatography, hydrophobic interaction chromatography, ion exchange chromatography, size exclusion chromatography.
6. A fusion DNA comprising a DNA fragment encoding MAP protein and a DNA fragment fused in frame encoding the heterologous protein of interest.
7. The fusion DNA of claim 6, further comprises an enterokinase cleavage site.
8. The fusion protein of claim 7, is cleaved at enterokinase site of the fusion protein.
9. The MAP protein of claim 7, having nucleotide sequence of SEQ ID 1.
10. The MAP protein of claim 7, having amino acid sequence of SEQ ID 2.
MAP FUSION PROTEIN
FIELD OF THE INVENTION
The present invention relates to a process for producing heterologous proteins of interest
using methionine aminopeptidase (MAP) protein as a fusion tag. Further the invention
relates to fusion protein DNA sequences comprising MAP protein.
BACKGROUND OF THE INVENTION
Recent advances in techniques related to recombinant DNA cloning in last two decades
has led to increase in the number of proteins expressed in large scale. These proteins
have therapeutic, diagnostic or industrial importance. The recombinant proteins can be
expressed in variety of different expression systems like bacterial, fungal, yeast and
mammalian cell systems. Each of the above systems has their own advantages and
disadvantages. Though mammalian expression systems will express correctly folded
proteins, the overall yields of protein of interest in this expression system are very low and
the cost of production is relatively highest in comparison to other expression system.
The cloning and expression of foreign proteins in E. coli is highly efficient since E. coli
offers high productivity, high growth and production rate, ease of use and economical. E.
coli facilitates protein expression by its relative simplicity, is inexpensive, fast growth, wellknown
genetics and the large number of compatible tools available for biotechnology.
However, there are a few disadvantages like lack of post-translational modifications, lack
of proper secretion system for efficient release of produced protein into the growth
medium, inefficient cleavage of amino terminal methionine which can result in lower
protein stability and increased immunogenicity, limited ability to facilitate extensive
disulphide bond formation, improper folding resulting in inclusion body formation etc.
However, when heterologous proteins are expressed in E coli in high levels, recombinant
proteins are frequently expressed in E. coli as insoluble protein aggregates termed as
"inclusion bodies". In general small proteins (>30 kDa) that are simple monomeric proteins
can be found in the soluble fractions of bacterial extracts. In contrast, proteins (<30 kDa) or
proteins that have complex secondary or tertiary structures are typically insoluble and are
predominantly found in inclusion bodies. Although initial purification of inclusion body
material is relatively simple, the protein must be subsequently refolded into an active form
which is typically a cumbersome process. If these additional procedures are not successful
then little or no protein activity is recovered from the host cells. Thus, it is much more
desirable to express the recombinant protein in soluble form.
Several approaches, including protein fusions, chaperone co-expression, and promoter
alterations, have been used to overcome these problems (Zhang Y, Olsen DR, Nguyen
KB, Olson PS, Rhodes ET, Mascarenhas D, 1998, Expression of eukaryotic proteins in
soluble form in Escherichia coli, Protein Expr. Purif. 12, 159-1 65; Thomas JG, Baneyx F,
1997 Divergent effects of chaperone overexpression and ethanol supplementation on
inclusion body formation in recombinant Escherichia coli, Protein Expr. Purif. 11, 289-
296). Unfortunately, these methods are not widely applicable. One of the strategies to
prevent formation of protein aggregates is to tag the protein of interest with a fusion protein
with a protein known to have been soluble at very high levels. Several commercial fusion
protein tags are available in market like Intein, maltose binding protein (Pryor KD, Leiting
B1997 High-level expression of soluble protein in Escherichia coli using a 6X His-tag and
maltose-binding-protein double-affinity fusion system, Protein Expr. Purif. 10, 309-319.),
Glutathione S transferase (Nygren PA, Stahl S, Uhlen M 1994 Engineering proteins to
facilitate bioprocessing, Trends Biotechnol. 12,1 84-1 88.), SUMO tags (Marblestone JG,
Edavettal SC, Lim Y, Lim P, Zuo X, Butt TR 2006 Comparison of SUMO fusion technology
with traditional gene fusion systems: Enhanced expression and solubility with SUMO,
Protein Sci. 15, 182-1 89.), ZZ tag, NusA (Marco VD, Stier G, Blandin S, Marco AD 2004
The solubility and stability of recombinant proteins are increased by their fusion to NusA,
Biochem. Biophys. Res. Commun. 322, 766-771 .), Ubiquitin (Catanzariti AM, Soboleva
TA, Jans DA, Board PG, Baker RT 2004 An efficient system for high-level expression and
easy purification of authentic recombinant proteins, Protein Sci. 13, 1331-1339.) etc.
Methionine aminopeptidases are ubiquitously distributed in all living organisms. The
removal of the N terminal methionine is a critical step for protein modifications that are
important in controlling protein subcellular localization and/or protein degradation. Two
distantly related MetAP enzymes, type 1 and type 2, are found in eukaryotes, while
prokaryotes express only one type of MAP. MetAP I exit in eubacteria while MetAP I I
exists in archae ( Li X, Chang YH 1996, Evidence that human homologue of a rat initiation
factor -2 associated protein (p67) is a methionine aminopeptidase Biochem Biophysics
Res Comm 227-1 , 152-9 ; Dummitt B, Micka W, Chang YH 2003 N-terminal methionine
removal and methionine metabolism is Saccharomyces cerevisiae J Cell Biochem 89:964-
974).
N-terminal methionine removal in bacteria is a two step process requiring the removal of
the N formyl group by polypeptide deformylase first followed by cleavage of the N terminal
methionine when the adjacent amino acid is small. Both the above steps appear to be
essential for bacterial cell viability. Failure to remove the N terminal methionine can lead to
inactive enzymes (e.g. glutamine phosphoribosylpyrophosphate aminotransferase and N
terminal nucleophile hydrolase).
The invention relates to use of MAP protein as a fusion tag to obtain a soluble protein of
interest in E.coli cells.
SUMMARY OF THE INVENTION
In an aspect the invention relates to a process for the production of the heterologous
protein in E. coli cells, the process comprises of:
a) preparing a fusion DNA comprising a first DNA fragment encoding MAP protein and a
second DNA fragment fused in the frame encoding the heterologous protein of interest,
b) cloning of the vector comprising the fusion DNA of step a,
c) expressing the fusion protein in E. coli cells in soluble form,
d) obtaining protein from the fusion protein and
e) purifying the protein.
In another aspect, the invention is related to a fusion protein DNA sequence comprising
MAP protein sequence fused to a DNA of the heterologous protein of interest.
In another aspect, the invention provides a process for the production of heterologous
protein as a soluble fusion protein using a MAP protein as a fusion tag.
DESCRIPTION OF THE DRAWINGS AND SEQ ID.
Figure 1: Schematic representation of vector map of pET21-MapF
SEQ ID NO. 1 : DNA sequence of MAP protein
Sequence ID no. 1: MAP DNA sequence (200230—200365), 795 bp
atggctatctcaatcaagaccccagaagatatcgaaaaaatgcgcgtcgctggccgactggctgccgaagtgctggagat
gatcgaaccgtatgttaaaccgggcgtcagcaccggcgagctggatcgcatctgtaatgattacattgttaatgaacaac
acgcggtttctgcctgcctcggctatcacggctatccgaaatccgtttgcatctctattaatgaagtggtgtgccacggt
atcccggacgatgctaagctgctgaaagatggcgatatcgttaacattgatgtcaccgtaatcaaagatggtttccacgg
cgatacctcgaaaatgtttatcgtcggtaagccgaccatcatgggcgaacgtctgtgccgcatcacgcaagaaagcctgt
acctggcgctacgcatggtaaaaccaggcattaatctgcgcgaaatcggtgcggcgattcagaaatttgtcgaagcagaa
ggcttctccgtcgttcgtgaatattgcggacacggtattggtcgcggcttccatgaagaaccgcaggtgctgcactatga
ctcccgtgaaaccaacgtcgtactgaaacctgggatgacgttcaccatcgagccaatggtcaacgcgggtaaaaaagaga
tccgcaccatgaaagatggctggacggtaaaaaccaaagatcgcagcttgtctgcacaatatgagcatactattgtggtg
actgataacggctgcgaaattctgacgctacgcaaggatgacaccatcccggcgataatctcgcacgacgaataa
SEQ ID NO. 2 : Amino acid sequence of MAP protein
Sequence ID no. 2: MAP aminoacid sequence (275 aminoacid seq)
MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGY
HGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGER
LCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLH
YDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGC
EILTLRKDDTIPAIISHDE HHHHHHDDDDK
DETAILED DESCRI PTION OF THE INVENTION
As used herein, "heterologous protein" or "protein of interest" refers generally to peptides
and proteins exogenous i.e. foreign to the E. coli cells. Examples of the protein includes
molecules such as, colony stimulating factors (CSFs), for example M-CSF, GM-CSF, and
G-CSF; growth hormone, including human growth hormone; interferon such as interferonalpha,
-beta, and -gamma; interleukins (ILs), such as IL-2, IL-1 1, IL-1 RA; reteplase,
staphylokinase, Steptokinase DPP-4, DPP-8, PTH, PDGFAA, PDGFAB, PDGFBB and
fragments of any of the above-listed polypeptides.
In an embodiment of the invention there is provided a fusion DNA comprising MAP protein
and an enzymatic cleavage site. In another embodiment there is provided a fusion DNA
comprising MAP protein and an enzymatic cleavage site wherein the fusion tag increases
the solubility of the protein of interest.
In another embodiment there is provided a vector comprising the fusion DNA comprising
MAP protein an enzymatic cleavage site, protein of interest.
In an embodiment there is provided a process for producing heterologous peptides or
proteins in a soluble and stable form in E. coli cells. Specifically, the invention provides a
method for producing a protein of interest in the soluble form comprising:
a) obtaining a fusion DNA comprising a first DNA encoding MAP protein, Enterokinase site
and a second DNA fused in the frame encoding the heterologous protein of interest,
b) cloning of the vector comprising the fusion DNA of step a,
c) expressing the fusion protein in E. coli cells in soluble form,
d) obtaining protein of interest from the fusion protein and
e) purifying the protein of interest.
In another embodiment any commercial vector and promoter may be used such as
pET21a, pBAD24, pQE, etc. The preferred vector is pET21a.
In an embodiment of the invention any enzymatic cleavage site may be used such as
enterokinase, TEV protease, Factor Xa and thrombin etc. The preferred enzyme cleavage
site is of enterokinase .
The process of the invention provides to express protein of interest as soluble entities in E
coli cells which are reported to be usually expressed in insoluble form (inclusion bodies).
To obtain the protein of interest from the inclusion bodies, processes like harsh
denaturation conditions, refolding etc are required which are tedious, time-consuming, not
universal and expensive and not applicable for large scale manufacturing scale operations.
In another embodiment the protein of interest which may be expressed by the present
invention are cytokines, hormones, thrombolytic agents, cleavage enzymes, enzymes
related to glycosylation or deglycosylation like PNGaseF, endo HF, , restriction enzymes
and the like. Cytokines includes Interleukins, Interferons, Growth factors, Colony
Stimulating factors and the like. Hormones includes PTH, FSH, GH, LH and the like.
In an embodiment of the invention the present invention may be used to express the
protein of interest which require external supply of rare codons for example interferon or
proteins which have strong secondary mRNA structure for example IL-2.
In an embodiment of the invention MAP protein is used as a fusion tag to express proteins
of interest in E. coli cells is less in size(MAP is 39 kDa) as compared with other tags like
NusA tag, the molar ration of the fusion tag versus protein of interest will be low which in
turn results in higher yield of the proteins of interest after separation from the fusion
partner.
In an embodiment of the invention the gene of interest was amplified from a template and
digested with BamHI/Hindlll and cloned into pETMAPF vector. The resultant clone was
screened with colony PCR and confirmed by restriction digestion. The clones were then
introduced into DE3 cells and were used for expression analysis using 1mM IPTG. The
induced cultures were pelleted, lysed by homogenizer and soluble and insoluble fraction
was separated by centrifugation. The samples were then analysed on SDS-PAGE. The
fusion expressed as a soluble protein was treated with enterokinase to get protein of
interest.
In a further embodiment of the invention provided for a fusion protein DNA and the
process to expresses the proteins in soluble fraction when expressed as N terminal fusion
protein.
The fusion DNA comprises of MAP protein with an enterokinase site (EK) at C terminus
and a 6X His tag at its N terminus. EK site ensures the generation of authentic N terminus
of protein of interest after cleavage of the fusion protein with enterokinase, while the N
terminus 6X His tag aids in purification of the fusion protein through a single step of metal
affinity chromatography.
In an embodiment where several molecules ranging from small molecules like human IL-2
(14 kDa) to large molecules like PNGaseF (36 kDa) to a molecule having several
disulphide linkages like reteplase (9 disulphides) have been demonstrated to be
successfully expressed as MAP fusion proteins using the process of the invention. The
proteins of the invention fractionated into the soluble fraction of the E. coli cells. Thus
providing for soluble fractions of the protein of interest expressed by the process of the
invention.
In another embodiment of the invention the protein of interest is obtained in correctly
folded form like PNGaseF protein was found to be active after enterokinase digestion.
The Enterokinase site may be optionally replaced by other cleavage enzymes like TEV
protease, Factor Xa and thrombin etc.
Other aspects and advantages of the present invention will be apparent upon
consideration of the following detailed description of preferred embodiments thereof.
Example 1: Cloning, expression and purification of MAP molecule
MAP molecule was amplified using following gene specific primers using E. coli cells
genomic DNA. The primers used were 5' CCG CCG GAA TTC CAT ATG GCT ATC TCA
ATC AAG ACC CCA GAA 3' and reverse primer which contains histidine 6x tag, 5' CCG
CCG GAA TTC AAG CTT TTA ATG ATG ATG ATG ATG ATG TTC GTC GTG CGA GAT
TAT CGC 3' and annealing temperature used was 50 °C for first five cycles and 60 °C for
remaining 25 cycles.. The amplified MAP gene was digested with Ndel and Hindi 11and
cloned in pET21 a vector.
Plasmid DNA was isolated from the cultures and restriction analysis was done to confirm
the release of insert by Nde1/Hindlll digestion. The resultant clones were designated as
pETMAP.
The clones were then introduced into DE3 cell line and were used for expression analysis.
The BL21 (DE3) pETMAP clones were inoculated into 50 ml LB amp and kept in orbital
shaker at 37 °C. The cultures were induced with 1 mM IPTG and after 4 h were pelleted at
8000 rpm for 10 min. The pellets obtained were then lysed with homogenizer and soluble
and insoluble fractions were separated by centrifuging at 13000 rpm for 20 min. The
protein expression was analyzed on SDS- PAGE gel.
The MAP protein is expressed completely in soluble fraction. The MAP protein was further
purified using Nickel NTA agarose and the bound protein eluted from column was pure
shows the purified MAP protein.
example 2 : cloning and construction of map fusion vector
MAP gene was amplified using E. coli cells gene as template with following primers as
forward primer 5' CCG CCG GAA TTC CAT ATG GCT ATC TCA ATC AAG ACC CCA
GAA 3' and reverse primer 5' CCG CCG GAA TTC AAG CTT TTA ATG ATG ATG ATG
ATG ATG TTC GTC GTG CGA GAT TAT CGC 3'. The amplified PCR product was cloned
into pET21a vector at Ndel BamHI sites. The clones were confirmed by restriction
digestion. The resultant vector was designated as pETMAPF and vector map is given in
Figure 1.
The clones were introduced into BL21 A 1 cell line and were inoculated in 50 ml LB amp
and induced after 1h with 13 mM arabinose and 1% lactose for 4h. The cell were pelleted
and disrupted in a cell disruptor. The lysed cell suspension was centrifuged at 13000 rpm
for 20 min and the soluble and insoluble fractions were separated. The protein expression
was analyzed on a 13 % SDS- PAGE.
It was found that MAP protein was completely restricted to the soluble fraction of the E.
coli cytoplasm.
This vector was designated as pMAPF and contains MCS site with BamHI, Hindi 11, EcoRI,
Sacl, Sail, Xhol etc sites. This vector was used for cloning of different genes to get soluble
expressions for the respective proteins. The vector was designed in such a way that after
enterokinase digestion, the protein of interest will have authentic amino acid.
Example 3 : Cloning and expression of reteplase molecule as MAP fusion
Reteplase (RTP) is a protein having high molecular weight 39 kDa containing 9 disulphide
bonds. RTP molecule was amplified from a synthetic template and digested with BamHI
and Hindlll and cloned into pETMAPF vector (MAP without stop codon). The primers used
for amplification were as follows forward primer 5' CCG CCG GGA TCC GAT GAT GAT
GAT AAA TCT TAC CAA GGC AAC AGC GAT TGC 3'and reverse primer 5' CCG GAA
TTC AAG CTT TTA CGG TCG CAT GTT GTC ACG AAT CCA 3' and annealing
temperatures were 50 °C for first five cycles and 60 °C for remaining 25 cycles. So the
resultant clone contains MAPRTP fusion with enterokinase site before N terminus of RTP.
The clone was confirmed with restriction digestion.
The clones were then introduced into a BL21 (DE3) cell line and were used for expression
analysis. The BL21 (DE3) MAPRTP clone was inoculated into 250 ml LB medium with
ampicillin (amp) and kept in orbital shaker at 37 °C. The cultures were induced with 1 mM
IPTG and after 4 h were pelleted at 8000 rpm for 10 min. The pellets were suspended in
10 mM Tris CI obtained was then lysed with homogenizer and soluble and insoluble
fractions were separated by centrifuging at 13000 rpm for 20 min. The protein expression
was analyzed on SDS- PAGE.
The MAP RTP fusion protein was expressed as a soluble protein. The RTP molecule was
expressed as a fusion of MAP protein was tested for activity using calorimetric assay and
blood clot lysis assay and was found to be active.
When MAPRTP fusion lysate was incubated with enterokinase, the fusion protein was
digested into two fragments MAP and RTP proteins.
Example 4 : Cloning and expression of PNGase F molecule as MAP fusion
PNgase F gene ( 1065 bp) is 39 kDa protein is used in removal of carbohydrate moeitis
from glycoproteins. The PNGase F gene was subcloned into pETMAPF vector at EcoRI
site from a synthetic template. The resultant clone contains MAPPNGaseF fusion with
enterokinase site before N terminus. The clones were confirmed with restriction digestion.
The clones were introduced into DE3 cell line and were used form expression analysis.
The DE3 MAP PNGaseF clones was inoculated into 250 ml LB amp and after 2 h was
induced with 1 mM IPTG and incubated in orbital shaker for 16h at 18 °C. The cells were
pelleted and lysed with homogenizer and soluble and insoluble fractions were separated
by centrifuging at 13000 rpm for 20 min. The MAP-PNGaseF fusion protein seen as 69
kDa band was expressed in the soluble fraction as seen on SDS-PAGE gel.
The BL21 (DE3) MAP-PNGaseF lysate was incubated with enterokinase and both
MAP and PNGaseF proteins were observed in SDS-PAGE gel.
Example 5 : Activity analysis of PNGaseF derived from MAP-PNGaseF clone:
The PNGaseF protein was digested and purified from E coli MAP-PNGaseF soluble
fraction. The purified protein was further analyzed for activity with help of two glycosylated
proteins eg. Staphylokinase and enterokinase derived from Pichia pastoris.
These two glycosylated proteins were incubated with purified PNFaseF at 37 for 2 hours
and samples were run on the 13.5% SDS -Page gel. The glycosylated Staphylokinase
protein runs at 18 kDa, after deglycosylation it was running at 14 kDa in the both inhouse
PNGaseF and Commercial PNGaseF treated samples. Similarly in the case of
glycosylated Enterokinase, after deglycosylation the size of enterokinase was reduced
from 43 kDA to 33 kDa.
Example 6 : Cloning and expression of IL-2 molecule as a MAP fusion
Interleukin 2 (IL-2) is a cytokine protein of 14 kDa size and used in therapeutic
applications. IL-2 gene was amplified from a synthetic template using forward primer 5'
CCG CCG GGA TCC GAT GAT GAT GAT AAA CCT ACT TCA AGT TCT ACA AAG 3'
and 5' CCG GAA TCC AAG CTT TCA AGT CAG TGT TGA GAT GAT GCT 3' digested
with BamHI Hindlll and cloned into pETMAPF vector. The resultant clone contains MAPIL-
2 fusion with enterokinase site before N terminus. The clones were confirmed with
restriction digestion.
The clones were introduced into DE3 cell line and were used form expression analysis.
The BL21 (DE3) MAP IL-2 clones was inoculated into 250 ml LB amp and after 2 h was
induced with 1 mM IPTG and incubated in orbital shaker for 16h at 18 °C. The cells were
pelleted and lysed with homogenizer and soluble and insoluble fractions were separated
by centrifuging at 13000 rpm for 20 min. The MAPIL-2 fusion protein was expressed in
soluble fraction as seen on SDS-PAGE gel.
Example 7 : Cloning and expression of IFN molecule as MAP fusion
IFN gene was amplified from a synthetic template using forward primer 5' CCG CCG GGA
TCC GAT GAT GAT GAT AAA TGT GAC CTA CCA CAA ACC CAC 3' and reverse primer
5' CCG CCG GAA TTC AAG CTT TTA TCA TTC CTT ACT TCT TAA ACT TTC 3'digested
with BamHI Hindlll and cloned into pETMAPF vector. The resultant clone contains
MAPIFN fusion with enterokinase site before N terminus. The clones were confirmed with
restriction digestion.
The clones were introduced into BL21 (DE3) cell line and were used form expression
analysis. The BL21 (DE3) MAP IFN clones was inoculated into 250 ml LB amp and after 2
h was induced with 1 mM IPTG and incubated in orbital shaker for 16h at 18 °C. The cells
were pelleted and lysed with homogenizer and soluble and insoluble fractions were
separated by centrifuging at 13000 rpm for 20 min. The MAPIFN fusion protein was
expressed in soluble fraction as seen on SDS-PAGE gel. The IFN protein was released
after enterokinase digestion of DE3 MAPIFN lysate. The most important advantage with
this vector is tRNA's for rare codons are not required since the expression of MAPIFN
fusion protein was achieved without supplementation of the specific rare codon tRNA's.
Example 8 : Cloning and expression of EGF as MAP fusion
Epidermal Growth factor (EGF) gene was amplified from a synthetic template using
forward primer 5' CCG CCG GGA TCC GAT GAT GAT GAT AAA AAT AGT GAC TCT
GAA TGT CCC CTG 3' and reverse primer 5' CCG CCG AAG CTT TAC GTA TTA GTG
CAG TTC CCA CCA CTT CAG 3' and digested with BamHI and Hindi 11and cloned into
pETMAPF vector. The resultant clone contains MAPEGF fusion with enterokinase site
before N terminus. The clones were confirmed with restriction digestion.
The clones were introduced into BL21 (DE3) cell line and were used form expression
analysis. The DE3 MAPEGF clones was inoculated into 250 ml LB amp and after 2 h was
induced with 1 mM IPTG and incubated in orbital shaker for 16h at 18 °C. The cells were
pelleted and lysed with homogenizer and soluble and insoluble fractions were separated
by centrifuging at 13000 rpm for 20 min. The MAP-EGF fusion protein was expressed in
soluble fraction.
Example 9 : Cloning and expression of human enterokinase as MAP fusion
Human enterokinase gene was amplified from a synthetic template and digested with
EcoRI Hindi 11 and cloned into pETMAPF vector. The resultant clone contains MAPEK
fusion with enterokinase site before N terminus. The clones were confirmed with restriction
digestion.
The clones were introduced into BL21 (DE3) cell line and were used form expression
analysis. The BL21 (DE3) MAP EK clones was inoculated into 250 ml LB amp and after 2 h
was induced with 1 mM IPTG and incubated in orbital shaker for 16h at 18 °C. The cells
were pelleted and lysed with homogenizer and soluble and insoluble fractions were
separated by centrifuging at 13000 rpm for 20 min. The MAPEK fusion protein was
expressed in soluble fraction.
When the soluble MAP-EK fusion protein was purified with nickel column, the MAPEK
fusion protein was self cleaved into MAP protein and EK protein.
Example 10: Cloning and expression of IFN, IL-2, RTP and EK gene in pET21a vector
without fusion tags:
IFN, IL-2, RTP and EK gene were amplified and cloned at pET21 a at Ndel Hindi I I site to
test the expression of the proteins without any tags. RTP and EK proteins were expressed
in BL 2 1 DE3 cell line were fractionated in insoluble fraction. IFN required rare codons to
express and were expressed only in insoluble fraction of BL21 DE3 codon plus cell line.
Also, IL-2 was expressed at very low levels in insoluble fraction BL21 DE3 cell line.
Example 1 1 : Cloning and expression of Ranibizumab heavy and light chain as MAP
fusion:
Ranibizumab heavy and light gene was amplified from a synthetic template and digested
with BamHI and Hindlll and cloned into pETMAPF vector. The resultant clones contain
MAPHC and MAPLC fusion with enterokinase site before N terminus. The clones were
confirmed with restriction digestion.
The clones were introduced into BL (DE3) cell line and were used form expression
analysis. The BL21 (DE3) MAPHC and MAPLC clones were inoculated into 30 ml LB amp
and after 1 h were induced with 0.5 mM IPTG and incubated in orbital shaker for 4 h at 18
°C. The cells were pelleted and lysed with homogenizer and soluble and insoluble
fractions were separated by centrifuging at 13000 rpm for 20 min. The MAPHC and
MAPLC fusion protein was expressed in soluble fraction.
Hence, MAP protein was successfully used as a fusion tag to fractionate heavy and light
chains of Ranibizumab into soluble fraction in E coli.
CLAIMS:
1. A process for the preparation of heterologous protein in bacterial cells comprising the
steps of:
a) Preparing a fusion DNA comprising a DNA fragment encoding MAP protein and
a DNA fragment fused in frame encoding the heterologous protein of interest,
b) Insertion of the fusion DNA of step a in a vector,
c) Cloning of the vector comprising the fusion DNA of step a,
d) Expressing the fusion protein in bacterial cells and extraction thereof from
bacterial cells,
e) Obtaining protein of interest from fusion protein,
f) Optionally purifying the protein of interest.
2. The process of claim 1, wherein the heterologous protein of interest is selected from the
group comprising of monoclonal antibodies, cytokines, growth stimulating factors,
hormones, interferons, interleukins and enzymes.
3. The process of claim 1, wherein the heterologous protein of interest is selected from the
group comprising of ranibizumab, parathyroid hormone (1-34), parathyroid hormone ( 1 -
84), reteplase, interferon, IL-2, IL-3, IL-4, IL-5, IL-6, IL-1 1 and GCSF.
4. The process of claim 1, wherein the bacterial cells are E. coli cells.
5. The process of claim 1, wherein the fusion protein is purified using one or more
chromatographic purification technique selected from the group consisting of affinity
chromatography, metal affinity chromatography, hydrophobic interaction chromatography,
ion exchange chromatography, size exclusion chromatography.
6. A fusion DNA comprising a DNA fragment encoding MAP protein and a DNA fragment
fused in frame encoding the heterologous protein of interest.
7. The fusion DNA of claim 6, further comprises an enterokinase cleavage site.
8. The fusion protein of claim 7, is cleaved at enterokinase site of the fusion protein.
9. The MAP protein of claim 7, having nucleotide sequence of SEQ ID 1.
10. The MAP protein of claim 7, having amino acid sequence of SEQ ID 2.
| # | Name | Date |
|---|---|---|
| 1 | Other Document [26-08-2016(online)].pdf | 2016-08-26 |
| 2 | Form 13 [26-08-2016(online)].pdf | 2016-08-26 |
| 3 | 935-MUMNP-2014-FORM 3 [12-04-2018(online)].pdf | 2018-04-12 |
| 4 | FORM 3.pdf | 2018-08-11 |
| 5 | 935-MUMNP-2014.pdf | 2018-08-11 |
| 6 | 935-MUMNP-2014-FORM 1(18-7-2014).pdf | 2018-08-11 |
| 7 | 935-MUMNP-2014-CORRESPONDENCE(18-7-2014).pdf | 2018-08-11 |
| 8 | 935-MUMNP-2014-FER.pdf | 2018-12-27 |
| 9 | 935-MUMNP-2014-AbandonedLetter.pdf | 2019-10-07 |
| 1 | strategy_935_27-12-2018.pdf |