Abstract: NA
1. Vaccine compositions comprising chimeric fusions of the HPV antigens with viral or bacterial proteins conferring enhanced immunogenicity useful for Hepatitis B virus as well as human papillomavirus (HPV) infections.
2. An immunogenic composition according to claim 1, wherein the HPV antigens are selected from a group comprising but not limited to HPV 16, HPV 18, HPV6, HPV11, HPV31, HPVi3, HPV35, HPV39, HPV45, HPV51, HPV52, HPV56, HPV58,HPV59,HPV6&.
3. An immunogenic composition according to claim 1, wherein the antigenic composition comprising of complete/partial sequences /mutants /variants of the HPV antigens selected from the list comprising LI, L2, E2, E5, E6 and E7 antigens or specific T cell or B cell epitopes of the said antigens either as single sequence or in tandem repeats in chimeric fusions with bacterial/viral proteins capable of inducing a strong antibody response when administered to the host.
4. An immunogenic composition according to claim 3, wherein the viral and bacterial proteins are selected from a list including but not limited to hepatitis B antigens such as hepatitis B core antigen, hepatitis B small antigen, inactivated tetanus toxoid, diphtheria toxoid, E.coli heat labile toxin, cholera toxin, Pseudomonas exotoxin A, Shiga toxin, listerolysin either singly or in combinations or epitopes derived from the aforementioned proteins thereof.
5. An immunogenic composition according to claim 4, wherein the antigenic composition consists of (chimeric fusions of HPV antigens with hepatitis B small antigen (HbsAg).
6. An immunogenic composition according to claim 3, wherein the HPV antigen comprises either the complete or partial sequences/epitopes of the capsid proteins such as LI and L2 or polypeptides derived from LI and/or L2 thereof and fused to the HbsAg such as in SEQ ID NO. 3 to SEQ ID NO. 13.
7. An immunogenic composition according to claim 3, wherein the HPV antigens comprises complete / partial sequence /mutants /variants / epitopes of the HPV early iproteins such as E2, E5, E6 and E7 either alone or in combinations thereof such as in SEQ ID No. 1 and 2.
8. An immunogenic composition according to claim 1 wherein the HPV antigens are fused either to the N-terminus or C-terminus or at any region within the open reading frame of the hepatitis B small antigen with or without the addition of linker sequence between the two sequences.
9. A Method for expressing the aforementioned HPV and HPV-HBsAg chimeric antigens of claim 1 comprising cultivating host cell transformed with antigen/ fusion antigen of claim 1 isolating and purifying the recombinant proteins there from.
10. The method according to claim 9 wherein the recombinant expression of the aforementioned HPV antigens is either as intracellular proteins or as secretary proteins in the host, it he host being either prokaryotic or eukaryotic expression system preferably yeast
11. A pharmaceutical composition comprising antigenic compositions of claims 1-10 in an effective amount to be used as vaccine and pharmaceutically acceptable carrier.
12. The pharmaceutical composition according to claim 11, wherein the antigens are used in the range of 10 ug - 1000 g of the protein per dose, preferably between 10 ug to 200 ug and most preferably between 10 ug to 100 ug
13. The pharmaceutical composition according to claims 11 and 12 further comprising a suitable adjuvant, the adjuvant being selected from at least one of the following: aluminium hydroxide, aluminium phosphate, monophosphoryl lipid A, other organic lipophilic compounds, CpG and non-CpG containing oligonucleotides, cytokines.
14. A Method of eliciting protective antibody response to antigenic composition and/or cytotoxic T cell response according to any preceding claims comprising administering the said composition to the subject that is in need for such treatment; by at least one of the routes such as oral, mucosal or parenteral routes oft administration.
15. The method according to claim 14 wherein the delivery of the aforementioned antigenic compositions is effected in pharmaceutically acceptable biodegradable polymers.
16. The use of the aforementioned antigenic formulations for prophylaxis or therapeutic treatment of papillomavirus infections and associated risk of cancer in mammals particularly in humans.
17. A vaccine composition useful for HPV and Hepatitis B infections and a method for preparing the same is substantially such as herein described with reference to the examples and figures.
The present invention related to vaccine composition useful for HPV and Hepatitis B infections and a method for preparing the same.
FIELD OF THE INVENTION:
The present invention relates to compositions of human papillomavirus (HPV) antigens and polypeptides derived from thereof used singly or in combinations and also as chimeric fusions with bacterial or viral antigens for prophylaxis and/or therapeutic treatment of HPV as well as Hepatitis B infections in mammals, particularly in human beings.
The present invention relates to a pharmaceutical formulation capable of eliciting protective antibody and cytotoxic T cell response against Human papillomavirus infection (HPV). The immunogenic formulation comprises purified recombinant HPV antigens in a stable formulatjion. The method of eliciting protective antibody and cytotoxic T cell responses Using monovalent, bivalent and multivalent chimeric vaccines is discussed. The immunogenic composition is formulated for in vivo administration to humans.
BACKGROUND OF THE INVENTION:
The Human papillomaviruses (HPVs) are double stranded DNA viruses that infect squamous and mucosal epithelia. The malignant epithelial neoplasms caused by the 'high-risk' or the oncogenic HPV types could progress to malignant cervical carcinoma (Bosch and de Sanjose, 2003). Persistent infection with HPV significantly correlates with progression to invasive carcinoma. The 'high risk' genotypes may progress differentially from tSIL (low grade squamous intraepithelial lesions) to malignancy (Schlecht et al. 2J)03). HPV is the major etiological factor for cervical cancer as almost 99.7 % of cervical cancer cases are found to have persistent HPV infections (Walboomers et al,j 1999). The incidence of HPV infection is common among sexually active young Women, and over 95% of the incident infections appear to resolve spontaneously over £ period of time. Invasive cervical carcinoma develops in less than 5% of HPV16 infedted women (Schlecht et al. 2003).
Of the nearly 100 types of HPV molecularly identified to date and more than 35 HPV types identified in the [genital tract, HPV 16 accounts for 50-60% of the cervical cancer cases in most countries, followed by HPV18 (10-20%), and HPVs 31 and 45 (4-5% each). Thus, HPV16 is! the most common type in all geographic regions with HPV 18 following closely, particularly being more common in Southeast Asia. While this pattern is common in Squamous cell carcinomas (SCCs) worldwide, HPV18 is most predominant in case of (adenocarcinomas (ADCs) followed by HPV16 (Clifford et al 2003). Epidemiological studies have shown mixed infection of several HPV genotypes.
Evidence from other itudies show that HPV 16 is more persistent (Richardson et al. 2003; Londesborough et jri. 1996), as well as and more likely to progress to CIN3 than other high-risk HPV genotypes. Thus, in HPV-based cervical screening programs, genotyping may have diagnostic utility in separating LSIL cases positive for HPV 16 (and perhaps HPV18 and otfyer genotypes), who require the closest surveillance, from LSIL cases infected with othe|r high-risk genotypes (Clifford et al. 2005).
Vaccination strategies based on available epidemiological data on the age and type specific distribution of; HPV infection could form the basis of developing an effective vaccine for controlling and eradicating human papillomavirus infection. Candidate vaccines that confer broad protective efficacy against multiple genotypes should be the strategy to consider for effective vaccination. The available vaccines using the LI capsid proteins ire type specific for HPV16 HPV18, HPV6 and HPV11 and offer inadequate protection to infection caused by other genotypes such as HPV31, HPV35, HPV52, HPV58 etc. which are also associated with progression to cervical carcinoma. There are no HPV vaccines available as yet, that offers cross protection against multiple HPV genotypps.
Two preventive vaccines comprising recombinant HPV LI virus-like particles (VLPs) have been licensed. They target only two of the approximately 15 known oncogenic HPV types. Although approximately 70% of cervical cancer cases are attributed to these two types and there is evidence for some degree of Cation of tross-protection against other closely related types. However, the current cost of these vaccines precludes sustained global delivery particularly in third world countries where the incidence of HPV infection is high.
BRIEF DESCRIPTION OF THE DRAWINGS:
Fig.l depicts PCR amplification of Hepatitis B small antigen (HepBsAg) gene.Lane 1: ~ 700 bp HbsAg gene; Lane 2t 100 bp DNA ladder
Fig.2 depicts PCR amplification of the multiepitope sequences of E6 and E7 synthetic gene fragment for construction of chimeric HbsAg-HPV chimera. Lanel: - 150 bp multiepitope gene fragment Consisting of the 129 bp of the multiepitope sequence; Lane 2: 100 bp DNA ladder
Fig.3 depicts PCR amplification HPV16 L2 ~ 530 bp gene fragment consisting of 510 bp of the HPV16L2 gene for generation of chmeric HbsAg-HPV sequence.; Lane 2: 100 bp DNA ladder
Fig.4 depicts PCR amplification of the HPV16 L2 fragment corresponding to amino acids 100-220 of the L2 gend to obtain - 380 bp PCR fragment that contains 360 bp of the specific sequence
Fig. 5: illustrates PCR amplification of the HPV16 LI gene fragment of 99bp amplified by PCR to obtain a - 120 bp fragment corresponding to amino acids 100-220 of the L2 gene to obtain - 380 bp PCR jfragment that contains 360 bp of the specific sequence
Fig. 6: illustrates PCR amplification of HPV18L1 gene gives a ~ 140 bp fragment consisting of 117 bp of the Hf V18L1 sequence
Fig.7: depicts PCR amplification of HPV18L1 gene gives a - 500 bp fragment consisting of 480 bp of HPV18 LI fragment.
Fig. 8: shows the expression l(pvel of the chimeric HbsAg -HPV protein detected for HbsAg content by ELISA and! taken as a measure of the expression of the chimeric protein in the induction cultures of Pichia pastoris
Fig. 9: relates to the expression level of the chimeric HbsAg -HPV protein detected for HPV antigen content by ELISA in the induction cultures of Pichia pastoris
Fig. 10 Immunogenicity of the chimeric proteins detected using HPV specific ELISA using primary antibody raised against the commercially available tetravalent vaccine and for HPV16 L2 the rabbit antfsera raised against the purified protein.
Fig. 11 Immunogenicity of the chimeric proteins detected using HbsAg specific ELISA using the commercially available kit. The antibody titer against the construct containing HPV 16 L2 protein was estimated using the rabbit antisera raised against the purified L2 protein.
SUMMARY OF THE INVENTION :
Accordingly, the! present invention provides a vaccine compositions comprising chimeric fusion of the HPV antigens with viral or bacterial proteins conferring enhanced immunogenicity useful for Hepatitis B virus as well as human papillomavirus (HPV) infections.
The HPV antigens may be selected from a group comprising but not limited to HPV16, HPV18, HPV6, HPVll, HPV31, HPV33, HPV35, HPV39, HPV45, HPV51, HPV52, HPV56, HPV58, HPV59, HPV68.
The antigenic composition comprising of complete/partial sequences /mutants /variants of the HPV antigens may be selected from the list comprising LI, L2, E2, E5, E6 and E7 antigens or specific T cell or B cell epitopes of the said antigens either as single sequence or in tandem repeats in chimeric fusions with bacterial/viral proteins capable of inducing a strong antibody response when administered to the host.
The viral and bacteria) proteins may be selected from a list including but not limited to hepatitis B antigens such as hepatitis B core antigen, hepatitis B small antigen, inactivated tetanus toxoid, diphtheria toxoid, E.coli heat labile toxin, cholera toxin, Pseudomonas exotoxin A, Srujga toxin, listerolysin either singly or in combinations or epitopes derived from the aforementioned proteins thereof.
The antigenic composition consists of chimeric fusions of HPV antigens with hepatitis B small antigen (HbsAg).
The HPV antigen comprises either the complete or partial sequences/epitopes of the capsid proteins such as 4,1 and L2 or polypeptides derived from LI and/or L2 thereof and fused to the HbsAg sucrj as in SEQ ID NO. 3 to SEQ ID NO.13.
The HPV antigens comprises complete / partial sequence / mutants /variants / epitopes of the HPV early proteins such as E2, E5, E6 and E7 either alone or in combinations thereof such as in SEQ ID No. 1 and 2.
The HPV antigens are fused either to the N-terminus or C-terminus or at any region within the open reading frame of the hepatitis B small antigen with or without the addition of linker sequence between the two sequences.
According to other aspect of this invention there is provided a Method for expressing the aforementioned HPV and HPV-HBsAg chimeric antigens of claim 1 comprising cultivating hot cell transformed with antigen/ fusion antigen of claim 1 isolating and purifying the; recombinant proteins there from.
The recombinant expression of the aforementioned HPV antigens may be either as intracellular proteins or is secretary proteins in the host, the host being either prokaryotic or eukaryotic Expression system preferably yeast
A pharmaceutical composition comprising antigenic compositions as disclosed herein before in an effective amount to be used as vaccine and pharmaceutically acceptable carrier.
The antigens are used in the range of 10 fig - 1000 ug of the protein per dose, preferably between 10 ug to 200 ug and most preferably between 10 ug to 100 ug
The pharmaceutical composition further comprising a suitable adjuvant, the adjuvant being selected from at leai one of the following: aluminium hydroxide, aluminium phosphate, monophosphorfl lipid A, other organic lipophilic compounds, CpG and non-CpG containing oligonucleotides, cytokines.
A Method of eliciting protective antibody response to antigenic composition and/or cytotoxic T cell resjxmse according to any preceding claims comprising administering the said composition to the subject that is in need for such treatment by at least one of the routes such as oral, mucosal or parenteral routes of administration. Aforementioned antigenic compositions is effected in pharmaceutically acceptable biodegradable polymers!
The use of the Aforementioned antigenic formulations for prophylaxis or therapeutic treatment of papillomavirus infections and associated risk of cancer in mammals particularly in humans
DETAILED DESCRIPTION OF THE INVENTION:
The invention covers the development of prophylactic and therapeutic vaccine candidates for human papillomavirus infections in humans. It is known in the prior art that the major capsid protein of HPV, the LI protein can assemble into Virus Like Particle (VLP) either alone or in combination with the minor capsid protein L2, when expressed as recombinant proteins in vitro. These virus like particles are immunogenic and have beeh used as vaccines for prophylaxis of HPV infections in humans. Cervical carcinom is caused by several 'oncogenic' HPV types including HPV16, HPV18, HPV31, HpV33, HPV35, HPV39, HPV45, HPV51, HPV52, HPV56, HPV58, HPV59, HPV68 ejto. VLPs comprising the LI capsid proteins are good vaccine candidates but the antibodies that recognize specific structural epitopes on the VLP are genotype specific abd the antibodies against one VLP type shows little or no cross reactivity against the other HPV genotypes. However, mixed infection of several HPV genotypes is common.
The scope of the ipresent invention is to develop a broad based vaccine that would offer protective immunity against the major HPV types that are associated with the risk of cervical carcinoma. The minor HPV capsid protein L2 potentially offers a broad neutralizing activity gainst several genotypes of the virus by virtue of higher sequence conservation in theL2 protein. However, unlike the structural epitopes of LI that are highly antigenic, L2 protein is relatively weakly immunogenic. Its low abundance in natural capsids- about 12-72 molecules per 360 copies of LI limits its immunogenicity (Pereira et d. 2009) A possible approach to broader immunity at lower cost is to consider vaccination against L2. L2 vaccines can be produced inexpensively and they also have the promise of conferring much broader cross-type protective immunity than that observed with LI VLP immunization (Kanda and Kondo 2009). The minor capsid protein L2 of HPV that plays important roles in virus entry into cells, localization of viral components to the nucleus, in DNA binding, capsid formation and stability elicits antibodies that are more cross-reactive between HPV types than does the major capsid protein LI, making it an attractive potential target for new-generation, more broadly protective subunit Vaccines against HPV infections.
One object of the inventor relates to increasing the immunogenicity of the candidate vaccine(s) by allowing presentation of multiple copies of the antigenic epitopes for enhancing immunogenicity by chimeric fusion with viral and bacterial proteins. So far no multi-epitope vaccine f6r HPV infection has been commercialized. Multi-epitope vaccines offer the advantage of broad protective activity by virtue of high sequence conservation amongst the Antigenic epitopes of the capsid and early proteins across different genotypes of the virus.
The virus like particles formed by hepatitis B small antigen (HbsAg) is a multimeric structure that is highly immunogenic when administered as a vaccine against hepatitis B virus infection. The structure of the VLP allows insertion of heterologous sequences from other proteins into its pen reading frame at discrete locations allowing the use of chimeric fusions of protens with HbsAg to be used as potential vaccine candidates. The HPV antigens include the capsid proteins LI and L2, and the early proteins such as El, E2, E5, E6 and E7. These proteins could consist of complete / partial sequence / mutants /variants / epitopes! of the HPV LI, L2, El, E2, E5, E6 and E7 proteins either singly or in combinations thereof. The T cell or B cell epitopes of these candidate proteins are used either singly or in tandem repeats and fused to the HbsAg are used as vaccine candidates for HPV vaccination. The HPV antigens are fused either to the N-terminus or C-terminus or at any region within the open reading frame of the hepatitis B small antigen with or Without the addition of linker sequence between the two antigens.
Chimeric fusion of the HPV capsid proteins to HbsAg has not been reported so far. Chimera of the minor HPV capsid protein L2 with HbsAg is attractive as vaccine candidate as the L2 protean although offering a broad neutralizing activity against multiple genotypes of the vims, is by itself a weak antigen as it is a linear polypeptide. Representation of the L2 regions responsible for its broad neutralizing activity against the multiple genotypes of the HPV virus as multimeric copies on the VLP of HbsAg increases its immunogenicit by virtue of representation of multiple copies on the VLP than when presented as a (single copy. The regions of the HPV16 and HPV18 LI proteins chosen for making the chimeric constructs with HbsAg also are those that have a broad neutralizing activity against other genotypes and could potentially offer cross-protection. We have exploited the flexibility of HbsAg whose self-assembly into virus like particles still allows chimeric fusion with heterologous sequences with other proteins. We have made a chimera of HbsAg with B cell and T cell epitopes of HPV E6 and E7 proteins that are presented in tandem to increase their immunogenic potential as well as with HPV16 and HV18 LI and L2 proteins. Chimeric construct of discrete regions of HPV E7 with HbjsAg protein has been reported. We have used multiple and B cell epitopes derived from E6 and E7 proteins of HPV as presence of these sequences in tandem elicit higher immunogenicity than when present as a single copy. Their presentation on the miltimeric VLP of HbsAg in turn increases the number of copies that are displayed on the VLP which further increases their immunogenicity and represents an excellent vaccine candidate. The B and T cell epitopes are known to elicit strong cytotoxic T cell responses offering the promise of a good therapeutic vaccine against HPV infections.
Those skilled in the art would identify that the following candidates could also be used in a similar strategy as chimeric sequences with HPV antigens in order to increase their vaccine potential. The list of candidates includes but is not limited to: hepatitis B core antigen, inactjvated tetanus toxoid, diphtheria toxoid, E.coli heat labile toxin, cholera toxin, Pseudoityonas exotoxin A, Shiga toxin, listerolysin, heat shock proteins, calreticulin or epitopes derived from the aforementioned proteins thereof.
The abovementionjed proteins can be expressed in either prokaryotic or eukaryotic expression systemsj as intracellular or secretory proteins. Pichia pastoris as an expression system is advantageous at industrial scale as it is cost effective and few proteins that have expressed and purified from Pichia pastoris have been successfully commercialized as it has been found safe for human use. This system would be applicable to yeast of any genus and species. The chimeric fusion of the HPV antigens with secretory signal of the (human serum albumin) to increase the synthesis and secretion of the protein into the culture medium enables not only high level of expression but also makes it easy to purify the protein at the scale of industrial fermentation. The sequence Of HSA at its N-terminus is compatible with high level of synthesis and efficient secretion in Pichia pastoris. Purification of the virus antigens using the proprietary Himapt technology facilitates isolation of the HbsAg-HPV chimeric antigens particularly VLPs in a cost-effective method that is safe for human application and economical fX the industrial scale than conventional density gradient ultracentrifugation on cesiunS chloride. This will enable the production of low cost vaccine and is environmental friendly to avoid the use of heavy metals like cesium chloride.
The proteins are expressed either as VLPs, capsomeres, polypeptides or chimeric polypeptides comprising HPV and the bacterial/viral antigens. The said antigens incorporated either a! s single sequence or in tandem repeats as chimeric fusions with bacterial/viral proteins; capable of inducing a strong antibody response or a cytotoxic T cell response iwhen administered to the host. Subunit immunogens containing copies of T- &id B-cell epitopes in tandem are potentially more immunogenic than when the^ occur as a single copy. The chimeric constructs with E6 and E7 epitopes as well with L2 and LI proteins have elicited a strong antibody response against both the HbfeAg and the HPV epitopes as determined by ELISA. This offers a vaccine for dual usfc, against both Hepatitis B and as well as with multiple genotypes of the HPV virus.
The antigenic compositions of the abovementioned proteins are formulated in pharmaceutical acceptable carrier for immunization in humans. The antigenic formulations can be administered either alone or with an adjuvant selected from a list that includes but is not Ignited to: aluminium hydroxide, aluminium phosphate, monophosphoryl lipid A, other organic lipophilic compounds, CpG and non-CpG containing oligonucleotides, j cytokines etc. Alternatively, the antigenic formulation could comprise two or more purified antigens that are mixed in vitro in a suitable formulation and used as a vaccine. The antigenic formulations can be delivered by one of the several methods either by oral, mucosal or by parenteral routes in mammals preferably in human subjects in order to elicit a protective antibody and/or cytotoxic T cell response. The antigen^ could also be delivered in pharmaceutically acceptable biodegradable polymers. The aforementioned formulations could be used for prophylaxis or therapeutic treatment of papillomavirus infections and associated risk of cancer in mammals.
HPV enters the body through mucosal cells and does not spread systemically. Therefore, an HPV vaccine will possibly have to induce a strong and sustained immune response at the genital mucosa. In this respect, nasal and oral immunization studies in animals have shown VLPs to induce antibodies in genital mucosa. Vaccines conferring mucosal immunity against HPV antigens are advantageous for prophylaxis of HPV infection. Formulations suitable for mucosal delivery of the vaccines would be tested. No such HPV vaccine is conkmercially available for mucosal application. The invention is further illustrated with the following examples. However these are only to be used for the purpose of illustration and should not construe the scope of protection.
Examples:
1. Example 1: Cloning Strategy
a) Strategy 1: Chimeric fusion of the multiepitopes derived from early proteins to
HbsAe:
This sequence consists of the hepatitis B small antigen fused to the multiepitope
derived from the HPV16 and HPV 18 E7 proteins that are in tandem, followed by
chimeric fusion of the multiepitope to the C-terminus and N-terminus of the HbsAg
protein. (HbsAg protein sequence:
MENTTSGFLGPLLVLQAGFFL^TRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSICPGYRWMCLRRFIIFLFlLLLCLISLLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTPAQGTSMFPSCCCTKPSDGN(Ttcipipsswafarflwewasvrfswlsllvpfvqwfvglspt VWLSVIWMMWYWGPSLYNILStFLPLLPISCCLWAYl).
The following epitopes derived from the E7 and/or E6 proteins are arranged in tandem to obtain: 5' EYMLDLQPEtTTEEDEIDGPAGQAEPDRAHYNIDEIDGVNHQHL 3 - 43 amino acids (129 nucleotides). This major epitope is a combination of the following and is selected from the list of T and B cell epitopes: HPV16 E7 T cell epitope: aa 20 - 29: TDtYCYEQLN; aa 45 - 54 AEPDRAHYNI; B CELL EPITOPES: aa 10 - 20: EYMLDLQPETT; aa 35 - 49 EEDEIDGPAGQAEPDR; fused to a HPV18 E7 B cell epitope DEIDGVNHQHL which is an immunodominant epitope of HPV18 E7 inorder to the bbtain the following chimeric fusion designated as SEQ ID No. 1. A similar chimeric fcsion of the multiepitope fused at the N-terminus of the HbsAg is the sequence provided in SEQ ID No.2. An initiator methionine for translation was introduced atithe 5 end of the multiepitope for initiation of translation.
SEQ ID No.l
MENTTSGFLGPLLVLQAGFFL^TRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFfrLLLCLrSLLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLLPISCCLWAYIGSEYMLDLQPETTEEDEIDGPAGQAEP DRAHYNIDEIDGVNHQHL-
SEQ ID NO.2:
MEYMLDLQPETTEEDEIDGPAGQAEPDRAHYNIDEIDGVNHQHLGSENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNf'LGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLLVLLDYQGMLpVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWftSVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNI LSPFLPLLPISCCLWAYI-
b) Strategy 2: Chimeric fusion of the minor capsid protein L2 to HbsAg.
The N-terminal region of the minor capsid protein L2 was fused to the HbsAg at the C-terminus of the HbsAg. The regions of L2 amplified are 171 amino acids of the following sequence (initiator1 methionine was introduced to facilitate translation) fused at the C-terminus of the HbsAg
MSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTPVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAE TGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSR
SEP ID NO. 3:
MENTTSGFLGPLLVLQAGFFLITRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFJ:LLLCLISLLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGN^TCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSF'FLPLLPISCCLWAYIGSSMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVPPVGPSDPSIVSLVEETSFIDAGAPTPVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFT[DPSVLQPPTPAETGGHFTLSSSTISTHNYEEIPMDTFIVSTNPNTV TSSTPIPGSR-
SEO ID NO. 4:
The minor capsid protein sequence L2 comprising 171 amino acids of the following sequence:
is fused at its C-terminus of the N-terminus of HbsAg to obtain SEQ ID NO 4 An initiator methionine has beef added for translation.
SMGVFFGGLGIGTGSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAWPVPSIPPDVSGFSiTTSTMTPAILDTMTLSSSriSrHNYEEIPMDTFIVSJrNPNTVTSSTPIPGSRGSENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFI
LCLISLLVLLDYQGMLPVCPPLLGtCSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWL^LLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPFLPLL
c) Strategy No.3:
Chimeric fusion of the nestd deletions of the L2 fragment to HbsAg.
The N-terminal region of the! minor capsid protein L2 was fused to HbsAg at the C-
terminus of the HbsAg. The iregion of L2 amplified is about 120 aa (360 bp) of the
following sequence:
SDPSIVSLVEETSFIDAGAPTPVPSIPPDVSGFSITTSTDTIPAILDINHTVTTVTTHNKPT
DPSVLQPPTPAETGGHFTLSSSIRISTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSR
It is ligated to the C-terminus 0f the HbsAg to obtain SEQ ID No.5
SEP ID No.5:
MENTTSGFLGPLLVLQAGFFLLfRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFliLLCLISLLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCfCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPfLPLLPISCCLWAYIGSSDPSIVSLVEETSFIDAGAPTPVPSIPPDVSGFSrTTSTDTTPAILDJNNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTIS THNYEEIPMDTFIVSTNPNTVTSTPIPGSR 3'
SEP ID No. 6:
The minor capsid protein sequence L2 comprising the following sequence of 120 amino
acids:
SDPSIVSLVEETSFIDAGAPTPVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSilSTHNYEEIPMDTFIVSTNPNTVTSSTPIPGSR
is chimerically fused at its C-terminus to the N-terminus of HbsAg to Obtain SEQ ID
NO.6 An initiator methionine vf'as added for translation.
MSDPSIVSLVEETSFIDAGAPTPIVPSIPPDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSS^TISTHNYEEIPMDTFRVSTNPNTVTSSTPIPGSRGSENTTSGFLGPLLVLQAGFFLLTRILTIEFQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLI^LLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCTCIIP^SWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVI WMMWYWGPSLYNILSPFLPLLPLLSCCLWAYI 3’
d) Strategy No. 4: Chimeric fusion of the HPV16 LI region with HbsAg:
Chimeric fusion of LI regioji of HPV16 protein at the C-terminus of HbsAg consisting of 33 amino acids derived from the LI region of the HPV16 protein (99 bp) of the
Sequence: NTVIQDGDMVDTGFCJiAMDFrTLOANKSEVPLDI
SEP ID No.7
MENTTSGFLGPLLVLQRGFFLLT4ILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSWHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIS^LVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYN ILSPFLPLLPISCCLWAYIGS NTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDI 3'
Chimeric fusion of LI regioi of HPV16 protein consisting of 33 amino acids derived from the LI region of the HPV16 of the sequence:
NTVIQDGDMVDTGFGAMDFTTLQA^KSEVPLDI to the N-terminus of HbsAg in order to obtain the chimeric sequence of SEQ ID No. 8. An initiator methionine has been added for translation.
SEP IP No. 8:
5'MNTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDIGSENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTC'TMPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSV^WMMWYWGPSLYNILSPFLPLLPISCCLWAYI 3'
e) Strategy No. 5: Chimeric fusion of HPV18 LI region to HbsAg:
Chimeric fusion of the regionjfrom HPV18 LI protein (39 amino acids; 117 bp) of the
following sequence
5' PPLELKNTVLEDGDMVDTGffGAMDFSTLQDTKCEVPLDI 3'
Fused to the C-terminus of the Hf)sAg sequence to obtain the following chimeric sequence:
SEPIPNP.9:
5'MENTTSGFLGPLLVLQAGFFLLTRRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFI|LLLCLISLLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCJTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPLPLLPISCCLWAYIGSPPLELKNTVLEDGDMVDTGYGAMDF STLQDTKCEVPLDI 3'
It is fused to the N-terminus if HbsAg protein to obtain the SEQ ID NO. 10 where an initiator methionine has been abided for translation.
SEP ID NP.10:
5'MPPLELKNTVLEDGDMVDTGXGAMDFSTLQDTKCEVPLDIGSENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLG$APACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLLVLLDYQGMLPVC^PLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASV^FSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYNILSPF LPLLPISCCLWAYI
f) Strategy No. 6: Chimeric fusion of a larger polypeptide of HPV18 LI region to HbsAg:
Chimeric fusion of a larger fragment of HPV18 consisting of the following sequence
ATSNVSEDVRDNVSVDYKQTQJLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWN RAGTMGDTVPQSLYIKGTGMR&SPGSCVYSPS
and fused at its N-terminusi to the C-terminus of the HbsAg to obtain the chimeric sequence:
SEQ ID NO. 11:
5’MENTTSGFLGPLLVLQAGFFLLITRILTIPQSLDSWWTSLNFLGGAPACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLLCLISLLVLLDYQGMLFVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNC|TCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYVIGPSLYNILSEIFLPLLPISCCLWAYIGSATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPL9QGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDCQSICKYPDYLQMSADPYGDSIMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMRASPGSCVYSPS 3'
Chimeric fusion of a larger fragment of HPV18 consisting of the following sequence: 5'
ATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWN RAGTMGDTVPQSLYIKGTGMRASPGSCVYSPS
and fused at its C-terminus t0 the N-terminus of the HbsAg to obtain the chimeric sequence of SEQ ID 12:
SEOIDNo.12:
MATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMRASPGSCVYSPSGSENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPGQN$QSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLLVLLDYQGMLPVCPPLLGKSNTTTTSTGPCKTCTMPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVI'FVQWFVGLSPTVWLSVLWMMWYWGPSLYNILSPFLPLLPISCCLWAYI
Strategy No. 1:
Chimeric fusion of the full length sequence of HPV16 LI protein at its N-terminus to the signal sequence of 24 amino acids of the human serum albumin for secretory expression in pichia pastorip in order to obtain SEQ ID NO. 13
SEQ ID NO. 13:
MKWTFISLLFLFSSAYSRGVFRRGSSLWLPSEATVYLPPVPVSKWSTDEYVARTNIYYHAGTSRLLAVGHPYFPIKKPNNNKILVPKVSGLQYRVFRIHLPDPNKFGFPDTSRYNPDTQRLVWACVGVEVGRGQPLGVGISGHPLLNKLDDTENASAYAANAGVDNRECISMLJIYKQTQLCLIGCKPPIGEHWGKGSPCTNVAVNPGDCPPLELINTVIQDGDMVDTGFGAMDFTTLQANKSEVPLDICTSI|CKYPDYIKMVSEPYGDSLFFYLRREQMF'VRHLFNRAGAVGENVPDDLYIKGSGSRANLASSNYFPTPSGSMVTSDAQJFNKPYWLQRAQGHNNGICWGNQLFVTWDTTRSTNMSLCAAISTSETTYKNTNFKEYLRHGEEYDLQFIFQLCKITLLTADVMTYIHSHNSTILEDWNFGLQPPPGGTLEDTYRFVTSQAIACQKHTPPAPKEDPLKKYTFWEVNLKEKFSADLDQFFPLGRKFLLQAGLKAKPKFTLGKRKATPTTSSTSTTAKRKKRKL
SEQ ID NO.14:
Chimeric fusion of the full! length sequence of HPV16 L2 protein at its N-terminus to the signal sequence of 24 i amino acids of the human serum albumin for secretory expression in pichia pastori in order to obtain SEQ ID NO. 14
MKWVTFISLLFLFSSAYSRGVFRRGJSRHKRSAKRTKRASATQLYKTCKQAGTCPPDIIPKVEGKTIADQILQYGSMGVFFGGLGIGTGJSGTGGRTGYIPLGTRPPTATDTLAPVRPPLTVDPVGPSDPSIVSLVEETSFIDAGAPTPVPSIPIJDVSGFSITTSTDTTPAILDINNTVTTVTTHNNPTFTDPSVLQPPTPAETGGHFTLSSSTISTHNYJEEIPMDTFIVSTNPNTVTSSTPIPGSRPVARLGLYSRTTQQVKWDPAFVTTPTKLITYDNPAYEJGIDVDNTLYFSSNDNSINIAPDPDFLDIVALHRPALTSRRTGIRYSRIGNKQTLRTRSGKSIGAiKVHYYYDFSTIDPAEEIELQTITPSTYTTTSHAASPTSINNGLYDIYADDFITDTSTTP^PSVPSTSLSGYIPANrTIPFGGAYNIPLVSGPDIPINITDQAPSLIPIVPGSPQYTIIADJAGDFYLHPSYYMLRKRRKRLPYFFSDVSLAA
SEQ ID No. 15:
Chimeric fusion of the full ilength sequence of HPV18 LI protein at its N-terminus to the signal sequence of 24 amino acids of the human serum albumin for secretory expression in pichia pastoris in order to obtain SEQ ID NO. 15:
MKWVTFISLLFLFSSAYSRGTFRRGSLWRPSDNTVYLPPPSVARWNTDDYVTRTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQL))IPKVSAYQYRVFRVQLPDPNKFGLPDNSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLLKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRR^QLFARHFWNRAGTMGDTVPQSLYIKGTGMRASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAI$GHNNGVCWHNQLFVTWDTTRSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDK1KFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSA PSATTSSKPAKRVRVRARK
2. Example 2: Gene cloning and the construction of HbsAg-HPV antigen chimeras:
a) Hepatitis B gene encoding (he full length HbsAg protein was PCR amplified with N-terminal and C-terminal primers containing EcoRl and BamHl restriction sites respectively to obtain a - 7Q0 bp PCR fragment (See Fig.l). The primers used for PCR amplification of the HbsAg gene are:
HBNTERM:
5' CACGAATTCACCATGJGAGAACACAACATCAGG3' HBCTERM:
5' TCAGGATCCAATGTAtTGCCCAAAGACAACAGG 3'
The conditions for PCR amplification were denaturation at 94°C for 45 seconds, annealing at 65°C for 40 seconds and extension at 72°C for 1.5 minutes for 30 cycles followed by final extension at 72°C for 10 minutes. 10 ng of the plasmid DNA containing HbsAg gene cloned in pBluescript SKII+ was used as the template for PCR reaction. The reaction consisted of 1 x Taq DNA polymerase buffer, 0.25 mM dNTPS, 20 picomoles of each primerjand 1.5 U of Taq DNA polymerse. All the reagents were from Bangalore Genei. The PCR fragment was gel purified and digested with BamHl. BamHl digested HbsAg PCft fragment was used for ligation with the various HPV antigens inorder to obtain the chimeric constructs. For construction of the chimeric
constructs which carried the HbsAg gene at the C terminus and the HPV antigens at the
N-terminus, the HbsAg was PpR amplified with a C-term primer that contained a Notl site and the N-term primer that contained the BamHl site. In the constructs used for PCR amplification where the |HPV antigens are at the N-term and HbsAg are at the C-term, the PCR primers for HI^V antigens contained an EcoRl site at their N-terminus and a BamHl site at their C-tlerminus. In both cases, chimeric fusion the HbsAg gene
and the HPV gene fragments *ere made through ligation at the BamHl end of both the
sequences. The BamHl site introduced two amino acids 'GS' (Glycine-Serine) at the junction of the HbsAg-HPV sequences. All chimeric fusions described in this disclosure (SEQ ID No.l to S$Q ID No. 15) has been carried out at the nucleotide level using polymerase chain reaction (PCR) and ligation of the PCR amplified genes.
The following HPV gene fragriients were amplified by PCR for ligation: Cloning of the mnltiepitope sequence:
EYMLDLQPETTEEDEIDGPGQAEPDRAHYNIDEIDGVNHQHL - 43 amino i acids (129 nucleotides). The sj[nthetic gene fragment encoding the above sequence was synthesized at GenScript Corporation. The gene fragment was amplified with the following primers that introduced a BamHl site at N'terminus and a Not 1 site at the C-terminus. PCR reaction was denaturation at 94°C for 45 seconds, annealing at 62°C for
45 seconds, and extension at 12°C for 30 seconds for 33 cycles inorder to obtain a -140 bp PCR fragment containing 129 bp of the epitope sequence. MENTERM primer:
5' ATAGGATCCGAGTACAiTGTTGGATTTG 3' MECTERM primer:
5' ATCGCGGCCGCTTATcicAAATGTTGGTGGTTG 3'
The 129 bp PCR fragment (See Fig.2) using the above primers was gel purified and digested with BamHl. The BamHl digested PCR fragment was ligated to BamHl digested HbsAg gene overnight using T4 DNA ligase inorder to obtain the chimeric fragment of- 840 bp whose translated sequence is designated as SEQ ID NO.l. The ligated fragment of the correct! size (~ 840 bp) was gel purified, digested with EcoRl and Not 1 for cloning into the yeast vector pPIC3.5K. In order to generate SEQ ID NO.2, wherein the multiepitope sequence is ligated at the 5 end of the HbsAg gene, primers of similar sequences i were made except that C-terminus primer carried a BamHl site instead of Notl site and in the N-term primer, the BamHl site was replaced with EcoRl. The PCR product of-140 bp was digested with BamHl, and ligated with BamHl digested HbsAg overnight with T4 DNA ligase. The ligated ~ 840 bp fragment designated as SEQ ID NO.2 Was gel purified, digested with EcoRl and Not 1 for cloning into the yeast expression vector, pPIC3.5K.
Chimeric fusion of the of the rtPV16 L2 fragment at the C-terminus of HbsAg. The N-terminal region of the minor capsid protein L2 was fused to the HbsAg at the C-terminus of the HbsAg. HPV16 L2 gene was synthesized at GenScript Corp. The regions of L2 amplified correspond to amino acids 50 - 220 (510 bp) and ligated at the C-terminus of the HbsAg to generate the SEQ ID NO.3. For ligation of the L2 gene fragment to the C-terminus of the HbsAg gene, the gene encoding the L2 protein was PCR amplified with a similar\ N-term primer containing BamHl site and a C-term primer containing Notl site. The PCR amplified - 530 bp fragment was digested with BamHl and ligated with BamMl digested HbsAg that carried a BamHl site at its C-terminus. The ligated - 1230 bp fragment was gel purified and digested with EcoRl and Notl for cloning into the yejast vector pPIC3.5K.
For generation of the HPV-HbsAg chimeric construct, the L2 gene (amino acid position 50 - 220bp) was amplified with primers of similar sequence except that the N-terminus primer carried a EcoRl site instead of BamHl and the C-term primer contained a BamHl site instead of Notl. The PCR amplification, digestion was as described above to obtain SEQ ID NO.4.
Chimeric fusion of the nested deletions of the HPV16 L2 fragment at the C-
terminus of HbsAg.
The N-terminal region of the ifrnor capsid protein L2 was fused to the HbsAg at the C-
terminus of the HbsAg. The regions of L2 amplified are 100 - 220 amino acids (120 aa;
360 bp). The primers used for pCR amplification of L2 gene fragment are:
6P2CFNTERM:
5' ACCGGATCCGATCCATCJTATCGTTTC 3'
6P2CFCTERM:
5' ATCGCGGCCGCTTATCACTTGAACCTGGAATTG 3’
PCR reaction was carried out jn a 50 uL volume containing lx Taq DNA polymerase
buffer, 0.25 mM dNTPs, and 20 picomoles of each primer and 1.5 U Taq DNA polymerase. The PCR conditions were denaturation at 94°C for 45 seconds, 64°C for 40
seconds and extension at 72°C for 1 min for 30 cycles.
The - 380 bp PCR fragment containing 360 bp of L2 sequence was gel purified, digested
with BamHl and ligated to BimHl digested HbsAg gene to generate the HbsAg-HPV
chimera of ~ 1060 bp designated as SEQ ID No. 5. For the generation of the HPV-
HbsAg chimeric sequence wherein the L2 gene fragment is ligated to the N'terminus of
the HbsAg gene, the N-term and C-term primers for L2 contained EcoRl and BamHl
restriction sites. The ligation wis carried out the with BamHl digested L2 gene fragment
and the BamHl digested HbsAg to generate the 1060 bp of the chimeric sequence designated as SEQ ID NO.6.
Generation of the chimeric sequence with LI region of HPV16 and HbsAg:
Generation of the chimeric sequence consisting of 33 amino acids derived from the LI region of the HPVli6 protein (99 bp) of the sequence:
NTVlQDGDMVDTGFGAMDpTTLQANKSEVPLDI with HbsAg gene. The specified region of the HPV16 LI gene (gene synthesized at GenScript Corporation) was amplified by PCR to obtain a~ 120 bp PCJR fragment containing the 99 bp of the above mentioned sequence was amplified using thie following PCR primers: 6P1CFNTERM: 5' ATCGGATCCAACACCGT+TATCCAAGACGG 3'6P1CFCTERM:
5' ACTGCGGCCGCTTATCAAATATCCAATGGAACTTC 3'
The PCR reaction was carried out in 50 uL reaction volume containing lx Taq DNA
polymerase buffer, 0.25 mM dNTPs, 20 picomoles of each primer and 1.5 U Taq DNA
polymerase (all reagents obtained from Bangalore Genei). The PCR cycle consisted of
denaturation at 94°C for 45 seconds, annealing at 65°C for 40 seconds, and extension at
72°C for 45 seconds for 30 cycles. The ~ 120 bp PCR fragment was gel purified,
digested with BamHl and ligat^d to the BamHl digested HbsAg overnight with T4
DNA ligase to generate a chimeric sequence of- 810 bp designated as SEQ ID No.7 in
which the HPV16 LI fragment (s C-terminal to the HbsAg gene. Inorder to generate a
HPV-HbsAg when the above mentioned fragment is ligated at the N-terminus of
HbsAg gene, the HPV16L1 fragment was PCR amplified with primers of similar
sequence containing a EcoRl site in the N-terminal primer and a BamHl sequence at
the C-term primer instead of Notl. The PCR fragment of similar size is digested with
BamHl and ligated to the BamHl digested HbsAg as described above to generate the
sequence designated as SEQ ID No.8.
Generation of the chimeric sequence with LI region of HPV18 and HbsAg:
Generation of the chimeric sequence of HPV18 LI protein (39 amino acids; 117 bp) of the following sequence
PPLELKNTVLEDGDMVDTGVGAMDFSTLQDTKCEVPLDI ligated to the C-temrinus of the HbsAg sequence by PCR. The synthetic HPV18 LI gene was codon optimized for expression in Picffia pastoris and was synthesized at GenScript Corporation. The HPV18 LI sequence specified above was PCR amplified with the with the following PCR primersj:
8P1CPNTERM:
5' GATGGATCCCCTCCTTT6GAATTGAAG 3'
8P1CFCTERM:
5' AGTGCGGCCGCTTATCAOTAATCTGGATATTTGC 3'
The PCR reaction was carried out in a 50 \iL volume and contained 1 x Taq DNA
polymerase buffer, 0.25 mM dNTPs, 20 pico moles of each primer and 1.5 U Taq DNA
polymerase. The PCR reactioft consisted of denaturation at 94 C for 45 seconds,
annealing at 65°C for 30 seconas and extension at 72°C for 40 seconds for 30 cycles.
The ~ 135 bp PCR fragment was gel purified, digested with BamHl and ligated to
BamHl digested HbsAg to obtain a HbsAg -HPV chimeric sequence where the
HPV18L1 sequence is ligated to the C-terminus of HbsAg to obtained the SEQ ID
No.9. For generation of the HPV-HbsAg chimeric sequence, the PCR primers contained a EcoRl site in thelN-term primer and a BamHl site in the C-term primer. After digestion with BamHl, |the fragment was ligated to the HbsAg that contained a BamHl at the N'terminal enal to generate the SEQ ID No.10. Both the ligated PCR fragments were digested Ecol^l and Not 1 for cloning into the yeast expression vector pPIC3.5K.
Generation of Chimeric Sequence of larger fragment of HPV18 LI with HbsAg:
Chimeric sequence of a larger fragment of HPV18 LI consisting of the following sequence
5'ATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLE DGDMVDTGYGAMDFSTLQDTKCEJVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHF WNRAGTMGDTVPQSLYIKGTGMFJASPGSCVYSPS 3'
was ligated to the C-terminus of the HbsAg by PCR. The LI fragment was PCR amplified with the following PCR primers:
8P1CFLFNTERM:
5' TCTGGATCCGCTACATCtAATGTCTC 3'
8P1CFLFCTERM:
5' ATTGCGGCCGCTTATCAGGATGGACTGTAAACG 3'
The 50 nL PCR reaction consisted of 1 x Taq DNA polymerase buffer, 0.25 mM dNTPs, 20 picomoles each of tr|e N- and C-term primers and 1.5 U of Taq DNA polymerase. The PCR reaction tonsisted of 1 x Taq DNA polymerase buffer, 0.25 mM dNTPs, 20 picomoles of each primer and 1.5 U Taq DNA polymerase. The PCR cycle consisted of denaturation at 94°b for 30 seconds, annealing at 64°C for 40 seconds and extension at 72°C for 1 min for|30 cycles. The PCR fragment was gel purified, digested with BamHl and ligated to the p-terminus of BamHl digested HbsAg to obtain the chimeric fragment of SEQ ID No. 11. For the ligation of the above mentioned HPV18 LI fragment to the N'terminus t>f the HbsAg sequence, the primers carried a EcoRl site for the N-term primer and a BajnHl site for the C-term primer. The BamHl digested fragment was ligated to the BarmHl digested HbsAg to obtain the chimeric sequence in which the HPV18 LI fragment is at the N-terminus of the HbsAg gene to obtain the SEQ ID No. 12. Both the above chimeric sequences were digested with EcoRl and Notl and ligated to the EcoR 1 and Not 1 digested yeast expression vector pPIC3.5 K for cloning in Pichia pastoris.
Generation of chimeric sequences of HPVjffltigens with the signal sequence of Human Serum albumin gene for secretory expression of HPV antigens in Pichia
pastorisx
The 24 amino acid signal sequence of human serum albumin gene was PCR amplified
with the following primers;
HASSNTERM;
5' CCTGAATTCACCATGAAGTGGGTAACCTTTATTTC3'
HASSCTERM:
5' ATTGGATCCTCGACGAAJACACACCCCTG 3'
to obtain a 72 bp fragment that Was gel purified, digested with BamHl and ligated
to the 5' end of the full length genes of HPV16 LI, HPV16L2 and HPV18 LI that
carried a BamHl site at the 5'eifrd to obtain the sequences SEQ ID No.13, SEQ ID
NO.14 and SEQ ID No.15 respectively.
Example 3: Cloning and Expression in Pichia Pastoris:
All the chimeric sequences wer0 verified by sequencing both the strands of the DNA for correctness of the chimeric sequence and the reading frame before proceeding with yeast transformation. All the chimeric sequences mentioned in the previous sections after digestion with EcoRl and ^otl were gel purified and ligated with EcoRl and Notl digested pPlC3.5 K vectoii (Invitrogen Corporation, Carlsbad, USA ) and ligated overnight with T4 DNA Hgase. The ligation mix was transformed in competent E.coli DH5a cells and plated in LB agir plate containing 100 ^ig/mL ampicillin. Plasmid DW was isolated from transformed tjlones for each of the constructs in large scale, purified and digested with Bgl II to linearize the plasmid for yeast transformation.
Essentially the linearized plasmfd DNA encoding the chimeric sequences from SEQ II No.I to SEQ ID No.15 were! transformed into Pichia Pastoris GS115 as per th manufacturers (Invitrogen) protocols and as outlined in their manual. All the chimeri sequences were cloned into thej AOXl locus and expressed under the AOX1 promote by methanol induction. The cjoning, screening, isolation of the recombinant Pichi strains and induction of the cloned gene with methanol were carried out as per th User's manual "A Manual of! Methods for Expression of Recombinant Proteins i Pichia pastoris" Version M Ja* 2002, of Pichia Expression Kit, Catalog # K1710-01 Invitrogen Corporation, Carlsbad, USA).
Example 4: Purification of Chimeric HbsAg-HPV antigens:
The cells after induction with methanol were harvested, and lysed by sonication and /or with glass beads. The lysate v^as treated with PEG6000 to a concentration of 7.5 % and NaCl upto 3%. The cell suspension was centrifuged at 8000 x g for 10 mia The supernatant was precipitated \^ith salt treatment (proprietary mix) and precipitated. The protein was eluted from the sa|t precipitate with Tris-HCl buffer, pH 8.5. The elute was concentrated and diafiltered with 50 mM Tris-HCl, pH 8.5 and loaded on a cation column equilibrated with thei same buffer. The protein was eluted with NaCl of different concentration for the different antigenic proteins. The purity of the preparation was checked on 12% SDS-PAGE with silver staining. The correct molecular sizes of the various chimeric proteins ^ere confirmed subsequently by Western blot.
Example 5: ELISA of the HPV-HbsAg chimeric proteins:
The expression of the chimeric proteins were detected by ELISA for the hepatitis B small antigen content by MC^NOLISA Anti-Hbs3.0 kit (product # 72400; Bio-Rad) exactly as the per the protocol Outlined in the kit manual and expressed in ng/mL. 100 uL of the cell lysate after induction was used for the estimation of HbsAg content. The estimation of HPV antigens in the chimeric proteins in the cell lysate after induction was also carried out by ELISA. 1 ujg of the purified proteins in 200 uL were coated on a 96-well microtiter plate in the presence of coating buffer (carbonate buffer, pH 9.6) and incubated overnight at 4°C. Tfee contents of the wells were discarded after tapping the plate on a paper towel to remove residual buffer in the wells. The wells were blocked with 225 pL/well of blocking Solution (1 x PBST containing 0.5% BSA) and incubated
at 37°C for hour.
The wells were washed three times with wash buffer (200 unwell, 30 seconds per wash). The plates were tappe4 dry on paper towel after each wash to remove residual buffer from the wells. The wells were washed in lx PBST (Phosphate buffer containing 0.5% tween 20) five times to remove the unbound proteins. Antibody for full length HPV6L1, HPV16 L2 and HPV18 LI raised in rabbit was used as the primary antibody. After addition of the primary antibody at 1:1000 dilution, the plates were incubated at room temperature for one hour with shaking. The contents of the wells were discarded and washed five times with w|ash buffer containing lxPBST. The secondary antibody anti-rabbit IgG-HRP conjugate was added at 1:2000 dilution in 10 mM phosphate buffered saline and incubated at room temperature for one hour with shaking. The contents of the wells were discarded and the plates were tapped on dry paper towel to remove residual buffer in the wells. 200 uL of freshly prepared substrate solution OPD (Orthophenylene diamine dihydrochloride) and hydrogen peroxide was added per well and incubated at room temperature for 30 min< The reaction was stopped by adding 75 uL of the stopping solution and the absorbance at 490 nm was read in the ELISA reader.
Example 6: Western blotting
The chimeric proteins as described in the previous sections were separated on 12% SDS-PAGE gel, electroblotted on PVDF (Hybond-P, GE Healthcare) membrane and blocked in a solution containing 10 mM phosphate buffer, pH7.4 containing 3% skimmed milk powder. After overnight blocking with the blocking solution, the blocking solution was discarded and rinsed 3x 5 minutes in PBST. The blot was incubated at 37°C with 1: 500 dilution of the primary rabbit-^ntisera raised with a commercially available tetravalent vaccine. After incubating with [primary antibody for one hour, the blot was washed five times and incubated at 1:2000 dilution in PBST of the secondary antibody i.e. anti-rabbit IgG HRPO conjugate and incubated at RT for one hour with shaking. The substrate diaminobenzidene (DAB) and hydrogen peroxide was added and color developed till the required color intensity was Achieved. The reaction was stopped by discarding the substrate solution and rinsing Vith WFI. Western blot detected HPV16 LI and HPV18 LI in the chimeric sequences with the antisera raised against the commercially available tetravalent HPV vaccine.
Example 7: Immunogenicity of the Chimeric proteins:
10 BALB/C mice (15-20g) in e^ch test group were immunized with 50 fig of the purified protein of each of the chimeric antigens absorbed in aluminum hydroxide gel and administered intramuscularly. A booster dose was given 21 days after the 1st dose and a second dose was administeredj after 45 days after the 1st dose. The antibody titer was measured by indirect ELISA fo|r all clones containing SEQ ID Nos. 3 -12 as outlined in the previous section. The antibody titer was estimated for both the HbsAg and the HPV antigens in mice immunized with the chimeric antigens. The primary antibody for estimation of HPV16L1 and IHPV18 LI was the rabbit antisera raised against the commercially available tetravalent vaccine except for clones expressing HPV 16 L2
protein which was measured1 with HPV16L2 rabbit antisera raised against the purified HPV16L2 protein. The antibody titer against the HPV antigens was measured by indirect ELISA in the pooled sera from each group of mice. The secondary antibody was rabbit anti-IgG HRPO conjugate. The experiment was repeated where the equivalent amount of antigens in algel were administered with 50 ug of CpG oligonucleotides per dose. The Antibody titer in all the mice Was estimated at 60-65 days after the administration of the initial dose of the antigen. For the estimation of antibody titer against the HbsAg in the immunized mice, the estimations were carried out with Monolisa Anti HBs 3.0 Kit from Bio-Rad laboratories exactly for per the manufacturer's instructions. The values were recorded at 490 run and plotteq.
References:
Christensen N., Reed C, Cladfil N., Han R and Kreider J, (1996): Immunization with viruslike particles induces lofig-term protection of rabbits against challenge with cottontail rabbit papillomavirus!. Journal of Virology 70, 960-965.
Kirnbauer R., Chandrachud L,, O'Neill B., Wagner E., Grindlay G., Armstrong A., McGarvie G., Schiller J., L0wry D. and Camp M. (1996): Virus-like particles of bovine papillomavirus type-4 Up prophylactic and therapeutic immunization. Virology 219,37-44.
Rose R., White W., Maolin %., Suzich J., Lane C. and Garcea R. (1998): Human papillomavirus type 11 recombinant LI capsomeres induce virus neutralizing antibodies Journal of Virology }2, 6151-6154.
Walboomers JM, Jacobs MV, llanos MM, Bosch FX, Kummer JA, Shah KV, Snijders PJ, Peto J, Meijer CJ, Munoz H Human papillomavirus is a necessary cause of invasive cervical cancer worldwide- J P^hol 1999; 189: 12-9.
Bosch FX, de Sanjose' S. Chapter 1: Human papillomavirus and cervical cancer-burden and assessment of causality. J Natl Cancer Inst Monogr 2003;31:3 - 13.
Schlecht NF, Piatt RW, Duarte-Franco E, et al. Human papillomavirus infection and time to progression and regression of cervical intraepithelial neoplasia. J Natl Cancer Inst 2003; 95:1336-43.
Richardson H, Kelsall G, Tellfcer P, et al. The natural history of type-specific human papillomavirus infections in fejnale university students. Cancer Epidemiol Biomarkers
Prev 2003, 12:485-90.
Londesborough P, Ho L, TTerry G, Cuzick J, Wheeler C, Singer A. Human papillomavirus genotype as a predictor of persistence and development of high-grade lesions in women with minor cervical abnormalities. Int J Cancer 1996, 69:364 - 8.
Clifford GM, Smith JS, Pl#nmer M, Munoz N and Francheschi S. Human papillomavirus types in invasivje cervical cancer worldwide: a meta-analysis. British J Cancer 2003; 88:63-73.
Clifford GM, Smith JS, PUlmmer M, Munoz N and Francheschi S. Human papillomavirus types in invasivb cervical cancer worldwide: a meta-analysis. British J Cancer 2003; 88:63-73.
Pereira R, Hitzeroth II, Rybicki EP. Insights into the role and function of L2, the minor capsid protein of papillomavirusesArch Virol. 2009;154(2):187-97).
Kanda T, Kondo K. Development of an HPV vaccine for a broad spectrum of high-risk typesHum Vaccin. 2009 Jan-Feb;5(l):43-5;
We claim:
1. Vaccine compositions comprising chimeric fusions of the HPV antigens with viral or bacterial proteins conferring enhanced immunogenicity useful for Hepatitis B virus as well as human papillomavirus (HPV) infections.
2. An immunogenic composition according to claim 1, wherein the HPV antigens are selected from a group comprising but not limited to HPV 16, HPV 18, HPV6, HPV11, HPV31, HPVi3, HPV35, HPV39, HPV45, HPV51, HPV52, HPV56, HPV58,HPV59,HPV6&.
3. An immunogenic composition according to claim 1, wherein the antigenic composition comprising of complete/partial sequences /mutants /variants of the HPV antigens selected from the list comprising LI, L2, E2, E5, E6 and E7 antigens or specific T cell or B cell epitopes of the said antigens either as single sequence or in tandem repeats in chimeric fusions with bacterial/viral proteins capable of inducing a strong antibody response when administered to the host.
4. An immunogenic composition according to claim 3, wherein the viral and bacterial proteins are selected from a list including but not limited to hepatitis B antigens such as hepatitis B core antigen, hepatitis B small antigen, inactivated tetanus toxoid, diphtheria toxoid, E.coli heat labile toxin, cholera toxin, Pseudomonas exotoxin A, Shiga toxin, listerolysin either singly or in combinations or epitopes derived from the aforementioned proteins thereof.
5. An immunogenic composition according to claim 4, wherein the antigenic composition consists of (chimeric fusions of HPV antigens with hepatitis B small antigen (HbsAg).
6. An immunogenic composition according to claim 3, wherein the HPV antigen comprises either the complete or partial sequences/epitopes of the capsid proteins such as LI and L2 or polypeptides derived from LI and/or L2 thereof and fused to the HbsAg such as in SEQ ID NO. 3 to SEQ ID NO. 13.
7. An immunogenic composition according to claim 3, wherein the HPV antigens comprises complete / partial sequence /mutants /variants / epitopes of the HPV early iproteins such as E2, E5, E6 and E7 either alone or in combinations thereof such as in SEQ ID No. 1 and 2.
8. An immunogenic composition according to claim 1 wherein the HPV antigens are fused either to the N-terminus or C-terminus or at any region within the open reading frame of the hepatitis B small antigen with or without the addition of linker sequence between the two sequences.
9. A Method for expressing the aforementioned HPV and HPV-HBsAg chimeric antigens of claim 1 comprising cultivating host cell transformed with antigen/ fusion antigen of claim 1 isolating and purifying the recombinant proteins there from.
10. The method according to claim 9 wherein the recombinant expression of the aforementioned HPV antigens is either as intracellular proteins or as secretary proteins in the host, it he host being either prokaryotic or eukaryotic expression system preferably yeast
11. A pharmaceutical composition comprising antigenic compositions of claims 1-10 in an effective amount to be used as vaccine and pharmaceutically acceptable carrier.
12. The pharmaceutical composition according to claim 11, wherein the antigens are used in the range of 10 ug - 1000 g of the protein per dose, preferably between 10 ug to 200 ug and most preferably between 10 ug to 100 ug
13. The pharmaceutical composition according to claims 11 and 12 further comprising a suitable adjuvant, the adjuvant being selected from at least one of the following: aluminium hydroxide, aluminium phosphate, monophosphoryl lipid A, other organic lipophilic compounds, CpG and non-CpG containing oligonucleotides, cytokines.
14. A Method of eliciting protective antibody response to antigenic composition and/or cytotoxic T cell response according to any preceding claims comprising administering the said composition to the subject that is in need for such treatment; by at least one of the routes such as oral, mucosal or parenteral routes oft administration.
15. The method according to claim 14 wherein the delivery of the aforementioned antigenic compositions is effected in pharmaceutically acceptable biodegradable polymers.
16. The use of the aforementioned antigenic formulations for prophylaxis or
therapeutic treatment of papillomavirus infections and associated risk of cancer in mammals particularly in humans.
17. A vaccine composition useful for HPV and Hepatitis B infections and a method
for preparing the same is substantially such as herein described with reference to the examples and figures.
| # | Name | Date |
|---|---|---|
| 1 | 1404-CHE-2008 POWER OF ATTORNEY 24-06-2008.pdf | 2008-06-24 |
| 2 | 1404-CHE-2008 FORM-1 24-06-2008.pdf | 2008-06-24 |
| 3 | 1404-CHE-2008 CORREPONDENCE OTHERS 24-06-2008.pdf | 2008-06-24 |
| 4 | 1404-CHE-2008 FORM-2 09-06-2009.pdf | 2009-06-09 |
| 5 | 1404-CHE-2008 DESCRIPTION(COMPLETE) 09-06-2009.pdf | 2009-06-09 |
| 6 | 1404-che-2008 form-18 03-05-2011.pdf | 2011-05-03 |
| 7 | 1404-che-2008 correspondence others 03-05-2011.pdf | 2011-05-03 |
| 8 | 1404-che-2008 form-5.pdf | 2011-09-03 |
| 9 | 1404-che-2008 form-3.pdf | 2011-09-03 |
| 10 | 1404-che-2008 form-1.pdf | 2011-09-03 |
| 11 | 1404-che-2008 drawings.pdf | 2011-09-03 |
| 12 | 1404-che-2008 description-(provisional).pdf | 2011-09-03 |
| 13 | 1404-che-2008 correspondence-others.pdf | 2011-09-03 |
| 14 | 1404-che-2008 correspondance others.pdf | 2011-09-03 |
| 15 | 1404-che-2008 claims.pdf | 2011-09-03 |
| 16 | 1404-che-2008 abstract.pdf | 2011-09-03 |
| 17 | 1404-CHE-2008 POWER OF ATTORNEY 16-04-2012.pdf | 2012-04-16 |
| 18 | 1404-CHE-2008 FORM-13 16-04-2012.pdf | 2012-04-16 |
| 19 | 1404-CHE-2008 CORRESPONDENCE OTHERS 16-04-2012.pdf | 2012-04-16 |
| 20 | 1404-CHE-2008 CORRESPONDENCE OTHERS 02-11-2012.pdf | 2012-11-02 |
| 21 | 1404-CHE-2008 FORM-3 02-11-2012.pdf | 2012-11-02 |
| 22 | 1404-CHE-2008 FORM-3 22-06-2015.pdf | 2015-06-22 |
| 23 | 1404-CHE-2008 CORRESPONDENCE OTHERS 22-06-2015.pdf | 2015-06-22 |
| 24 | Petition Under Rule 137 [21-12-2015(online)].pdf | 2015-12-21 |
| 25 | OTHERS [21-12-2015(online)].pdf | 2015-12-21 |
| 26 | Other Document [21-12-2015(online)].pdf | 2015-12-21 |
| 27 | Form 13 [21-12-2015(online)].pdf | 2015-12-21 |
| 28 | Examination Report Reply Recieved [21-12-2015(online)].pdf | 2015-12-21 |
| 29 | Description(Complete) [21-12-2015(online)].pdf_56.pdf | 2015-12-21 |
| 30 | Description(Complete) [21-12-2015(online)].pdf | 2015-12-21 |
| 31 | Correspondence [21-12-2015(online)].pdf | 2015-12-21 |
| 32 | Claims [21-12-2015(online)].pdf | 2015-12-21 |
| 33 | 1404-CHE-2008_EXAMREPORT.pdf | 2016-07-02 |
| 34 | 1404-CHE-2008-HearingNoticeLetter.pdf | 2017-10-26 |
| 35 | 1404-CHE-2008-REQUEST FOR ADJOURNMENT OF HEARING UNDER RULE 129A [21-11-2017(online)].pdf | 2017-11-21 |
| 36 | 1404-che-2008-ExtendedHearingNoticeLetter_20Dec2017.pdf | 2017-11-23 |
| 37 | 1404-CHE-2008-REQUEST FOR ADJOURNMENT OF HEARING UNDER RULE 129A [16-12-2017(online)].pdf | 2017-12-16 |
| 38 | 1404-CHE-2008-ExtendedHearingNoticeLetter_29Jan2018.pdf | 2017-12-18 |
| 39 | 1404-CHE-2008-Sequence listing [21-12-2017(online)].jpg | 2017-12-21 |
| 40 | 1404-CHE-2008-Response to office action (Mandatory) [21-12-2017(online)].pdf | 2017-12-21 |
| 41 | 1404-CHE-2008-RELEVANT DOCUMENTS [21-12-2017(online)]_130.pdf | 2017-12-21 |
| 42 | 1404-CHE-2008-RELEVANT DOCUMENTS [21-12-2017(online)].pdf | 2017-12-21 |
| 43 | 1404-CHE-2008-PETITION UNDER RULE 137 [21-12-2017(online)].pdf | 2017-12-21 |
| 44 | 1404-CHE-2008-Written submissions and relevant documents (MANDATORY) [12-02-2018(online)].pdf | 2018-02-12 |
| 45 | 1404-CHE-2008-MARKED COPIES OF AMENDEMENTS [12-02-2018(online)]_287.pdf | 2018-02-12 |
| 46 | 1404-CHE-2008-MARKED COPIES OF AMENDEMENTS [12-02-2018(online)].pdf | 2018-02-12 |
| 47 | 1404-CHE-2008-FORM 13 [12-02-2018(online)].pdf | 2018-02-12 |
| 48 | 1404-CHE-2008-Annexure (Optional) [12-02-2018(online)].pdf | 2018-02-12 |
| 49 | 1404-CHE-2008-AMMENDED DOCUMENTS [12-02-2018(online)]_291.pdf | 2018-02-12 |
| 50 | 1404-CHE-2008-AMMENDED DOCUMENTS [12-02-2018(online)].pdf | 2018-02-12 |
| 51 | 1404-CHE-2008-Amendment Of Application Before Grant - Form 13 [12-02-2018(online)].pdf | 2018-02-12 |
| 52 | 1404-CHE-2008-Sequence listing [13-02-2018(online)].jpg | 2018-02-13 |
| 53 | 1404-CHE-2008-Response to office action (Mandatory) [13-02-2018(online)].pdf | 2018-02-13 |
| 54 | 1404-CHE-2008-NBA Approval Submission [30-06-2022(online)].pdf | 2022-06-30 |
| 55 | 1404-CHE-2008-PatentCertificate08-09-2022.pdf | 2022-09-08 |
| 56 | 1404-CHE-2008-IntimationOfGrant08-09-2022.pdf | 2022-09-08 |