Abstract: The present invention relates to a method of identifying a compound involved in pain the use of Lrrfip1 nucleic acid or Lrrfip1 protein for identifying a compound involved in pain as well as methods of diagnosing algesia involving the same.
Description
Methods and uses relating to the identification of compound involved in pain
as well as methods of diagnosing algesia
The present invention relates to a method of identifying a compound involved in pain,
the use of Lrrfipl nucleic acid or Lrrfipl protein for identifying a compound involved in
pain as well as methods of diagnosing algesia involving the same.
Physical pain is a typical sensory experience that may be described as the unpleasant
awareness of a noxious stimulus or bodily harm. Individuals experience pain by various
daily hurts and aches, and sometimes through more serious injuries or illnesses. For
scientific and clinical purposes, pain is defined by the International Association for the
Study of Pain (IASP) as "an unpleasant sensory and emotional experience associated
with actual or potential tissue damage, or described in terms of such damage".
Pain of any type is the most common reason for physician consultation in the United
States, prompting half of all Americans to seek medical care annually. It is a major
symptom in many medical conditions, significantly interfering with a person's quality of
life and general functioning. Diagnosis is based on characterizing pain in various ways,
according to duration, intensity, type (dull, burning, throbbing or stabbing), source, or
location in body. Usually pain stops without treatment or responds to simple measures
such as resting or taking an analgesic, and it is then called 'acute' pain. But it may also
become intractable and develop into a condition called chronic pain, in which pain is no
longer considered a symptom but an illness by itself. In recent years, the study of pain
has attracted many different fields such as pharmacology, neurobiology, nursing,
dentistry, physiotherapy, and psychology.
Pain is part of the body's defense system, triggering a reflex reaction to retract from a
painful stimulus, and helps adjust behavior to increase avoidance of that particular
harmful situation in the future.
Medical management of pain has given rise to a distinction between acute pain and
chronic pain. Acute pain is 'normal' pain, it is felt when hurting a toe, breaking a bone,
having a toothache, or walking after an extensive surgical operation. Chronic pain is a
'pain illness', it is felt day after day, month after month, and seems impossible to heal.
In general, physicians are more comfortable treating acute pain, which usually is caused
by soft tissue damage, infection and/or inflammation among other causes. It is usually
treated simultaneously with pharmaceuticals, commonly analgesics, or appropriate
techniques for removing the cause and for controlling the pain sensation. The failure to
treat acute pain properly may lead to chronic pain in some cases.
A series of pharmaceuticals is known for the treatment of pain. However, side-effects
and resistance are common problems associated with known analgesics. Accordingly, it
is no surprise that a survey of American adults found pain was the most common
reason that people use complementary and alternative medicine.
This proves that new approaches and targets for pain therapy are still needed.
Surprisingly, it has now been found that Lrrfipl is involved in pain. In a screening assay
for the identification of genes involved in pain, three different inbred mouse strains
differing in their pain sensitivity were examined. The expression of various genes was
correlated with the pain sensitivity of the mouse strains. Among the genes showing the
best correlation between pain sensitivity and expression there was Lrrfipl (see
Example). Therefore, Lrrfipl is an interesting target for the identification of compounds
involved in pain and for the diagnosis of algesia.
Accordingly, the present invention provides in a first and second aspect, a method of
identifying a compound involved in pain, the method comprising the steps of:
a) providing a test system comprising a Lrrfipl nucleic acid or a Lrrfipl protein, or a
functionally active variant thereof,
b) contacting the test system with a test compound, and
c) determining the effect of the test compound on the test system,
wherein the test compound is identified as a compound involved in pain, when a
significant effect of the test compound on the test system relative to a control is
detected.
The first aspect of the present invention relates to a test system comprising a Lrrfipl
nucleic acid and the second aspect relates to a test system comprising a Lrrfipl protein,
or a functionally active variant thereof.
The test system of the invention may be used in order to elucidate mechanisms
involved in pain. Particularly, the test system may be used to develop, identify and/or
characterize agents involved in pain, which interact with a Lrrfipl nucleic acid or protein,
particularly activating or inactivating the same. The identified agent may be an
interesting therapeutic drug, which could be used in the treatment of pain, particularly in
neuropathic pain. Alternatively, Lrrfipl could be used in the diagnosis of algesia.
A variety of test designs is known in the art to which the test system according to the
present invention may be adapted. Further details on exemplary tests are given in the
methods of the invention. The test system may be used in order to determine the effect
of a test compound on the test system. The skilled person will be able to design a test
system, e.g. by adding further agents required in connection with the prevailing method,
suitable for the particular test method intend.
In addition to Lrrfipl nucleic acid or protein or functionally active variant thereof, the test
system of the invention may comprise one or more further components. Depending from
the test design and method of detection the test system may include, e.g. a known
Lrrfipl ligand, a component of the Lrrfipl signal transduction, means for detection etc.
The skilled person will be capable of adapting the test system to the study design, i.e.
be chosen suitable buffers, cofactors, a substrate, one or more different antibodies, a
marker, an enzyme or any other necessary agent. The test system may be in a cellular
system or a cell-free system, as appropriate under the prevailing conditions.
In a first step of the method of the present invention a test system comprising a Lrrfipl
nucleic acid, e.g. a Lrrfipl gene or Lrrfipl cDNA or Lrrfipl mRNA or Lrrfipl promoter, or
protein is provided.
The Lrrfipl gene or synonymously GCF2, TRIP or Flap gene encodes the
transcriptional repressor Lrrfipl . Lrrfipl is also referred to as Leucine-rich repeat
flightless-interacting protein 1, LRR FLII-interacting protein 1, TAR RNA-interacting
protein, GC-binding factor 2, GC-rich sequence DNA-binding factor, FLI-LRRassociated
protein 1 or short Flap-1 , H 186 FLAP, tcf-9, tcf9, transcription factor 9 or
NEDD8-conjugating enzyme.
The Lrrfipl protein belongs to the LRRFIP family. It is a poorly understood protein with
little homology to recognized transcription factor families. It has been previously
identified as a protein interacting with the human ortholog of Flightless-I of Drosophila
melanogaster. The protein acts as a transcriptional repressor which preferentially binds
to the GC-rich consensus sequence 5'-AGCCCCCGGCG-3' (SEQ ID NO: 7). It has
been suggested to regulate expression of TNF, EGFR and PDGFA. Thereby, Lrrfipl
has been reported to be a TNF-a repressor occupying the polymorphic promoter site of
the TNT-a promoter at nucleotide 308 in cells that do not produce TNF-a. The TNF-a
308 promoter polymorphism is a G-to-A transition which has been statistically
associated with various autoimmune disorders. Some studies have found that it may
directly mediate the increased transcription of TNF-a in some circumstances. Moreover,
the Lrrfipl protein is a positive regulator of NF-kappaB activity. It has also been
suggested to control smooth muscle cell proliferation following artery injury through
PDGFA repression and to bind to double-stranded RNA. It may also interact with FLU.
There appears to be a relationship between Lrrfipl and breast neoplasms and
glioblastoma. Lrrfipl is ubiquitously expressed and is located in the cytoplasm and the
nucleus.
Human Lrrfipl is composed of 808 amino acids (cf. UniProtKB/Swiss-Prot Q32MZ4
(LRRF1_HUMAN; SEQ ID NO: 1) . Amino acid sequences 485 - 584 constitute a DNAbinding
domain, amino acids 128 - 250 constitute a coiled coil domain and amino acids
567 - 593 represent a Lys-rich domain.
10 20 30 40 50 60
MTSPAAAQSR EIDCLSPEAQ KLAEARLAAK RAARAEAREI RMKELERQQK EEDSERYSRR
70 80 90 100 110 120
SRRNTSASDE DERMSVGSRG SLRVEERPEK DFTEKGSRNM PGLSAATLAS
LGGTSSRRGS
130 140 150 160 170 180
GDTSISIDTE ASIREIKELN ELKDQIQDVE GKYMQGLKEM KDSLAEVEEK YKKAMVSNAQ
190 200 210 220 230 240
LDNEKTNFMY QVDTLKDMLL ELEEQLAESR RQYEEKNKEF EREKHAHSIL QFQFAEVKEA
250 260 270 280 290 300
LKQREEMLEK HGIILNSEIA TNGETSDTLN NVGYQGPTKM TKEELNALKS TGDGTLGRAS
310 320 330 340 350 360
EVEVKNEIVA NVGKREILHN TEKEQHTEDT VKDCVDIEVF PAGENTEDQKSSEDTAPFLG
370 380 390 400 410 420
TLAGATYEEQVQSQILESSS LPENTVQVES NEVMGAPDDR TRTPLEPSNC WSDLDGGNHT
430 440 450 460 470 480
ENVGEAAVTQ VEEQAGTVAS CPLGHSDDTV YHDDKCMVEV PQELETSTGH SLEKEFTNQE
490 500 510 520 530 540
AAEPKEVPAH STEVGRDHNE EEGEETGLRD EKPIKTEVPG SPAGTEGNCQ EATGPSTVDT
550 560 570 580 590 600
QNEPLDMKEP DEEKSDQQGE ALDSSQKKTK NKKKKNKKKK SPVPVETLKD VKKELTYQNT
610 620 630 640 650 660
DLSEIKEEEQ VKSTDRKSAV EAQNEVTENP KQKIAAESSE NVDCPENPKI KLDGKLDQEG
670 680 690 700 710 720
DDVQTAAEEV LADGDTLDFE DDTVQSSGPR AGGEELDEGV AKDNAKIDGA TQSSPAEPKS
730 740 750 760 770 780
EDADRCTLPE HESPSQDISD ACEAESTERC EMSEHPSQTV RKALDSNSLE NDDLSAPGRE
790 800
PGHFNPESRE DTRGGNEKGK SKEDCTMS
SEQ ID NO: 1
There are several amino acid modifications within the protein. Amino acids 16, 115,
116, 120, 124, 521 , 581 , 6 18, 638, 7 13, 714 and 733 are phosphoserine residues and
amino acids 123, 295, 676 and 7 11 are phosphothreonine residues.
Three isoforms have been reported which are produced by alternative splicing. Isoform
1 (identifier: Q32MZ4-1 ) as represented by SEQ ID NO: 1, isoform 2 (identifier:
Q32MZ4-2) which differs from isoform 1 in that amino acids 137-1 60 are missing and
isoform 3 (identifier: Q32MZ4-3) which differs from isoform 1 in that amino acids 52-83
and 137-1 60 are missing.
A series of natural variants have been reported, i.e. 68 S C (VAR_036037) in a
breast cancer sample, 275 Q R (VAR_027291 ) dbSNP, 4 18 N S (VAR_027292)
dbSNP, 609 E K (VAR_027293) dbSNP, 633 K E (VAR_0561 11) dbSNP, 645 P
L (VAR_027294) dbSNP, 779 R G (VAR_027295) dbSNP and 783 H D
(VAR_027296) dbSNP.
The human gene Lrrfipl maps on chromosome 2, at 2q37.3.
Mouse Lrrfipl is composed of 729 amino acids (cf. UniProtKB/Swiss-Prot Q3UZ39
(LRRF1_Mouse; SEQ ID NO: 2). Amino acid sequences 465 - 567 constitute a DNAbinding
domain, amino acids 94 - 194 constitute a coiled coil domain and amino acids
530 - 563 represent a Lys-rich domain.
10 20 30 40 50 60
MTSPEGAQNK EIDCLSPEAQ RLAEARLAAK RAARAEAREI RMKELERQQK EVEERPDKDF
70 80 90 100 110 120
AEKGSRNMPS LSAATLASLG GTSSRRGSGD TSISMDTEAS IREIKDSLAE VEEKYKKAMV
130 140 150 160 170 180
SNAQLDNEKT NFMYQVDTLK DMLLELEEQL AESQRQYEEK NKEFEREKHA HSILQFQFAE
190 200 210 220 230 240
VKEALRQREE MLEKHGIILN SEIATNGETS DTVNDVGYQA PTKITKEELN ALKSAGEGTL
250 260 270 280 290 300
GKAKEVEVKK EIVEKVGQRE TLQNSEQEQP KPNTGKDCVD RGVSHPGEKA ENQRPAEDSA
310 320 330 340 350 360
LSPGPLAGAK CEQQVQSQDQ ENTSDLKNSE QIESHKVTNK SDSRASNSPE QSSCLEGLDS
370 380 390 400 410 420
EVPGPTEDLK TDLGKGSFEP CPDYILGQTA EIDKVTCTDS RGTGGNQRED EVQAGDTTVE
430 440 450 460 470 480
DQVGTVASGP AKQSKGTENH GESCLKDGLG QSSERELTQE VAEPEEAIVQ IPQAGGENTI
490 500 510 520 530 540
TKADDAEGRD EKPIQAEAQA SPGAPINQSG HQDTTGPGST DAQRTPPHAK ERKKQGKSEQ
550 560 570 580 590 600
QAEALDSPQK KTKNKKKKNK KKKAATPAET CRDANEELNC QDPDVGDMEE EERLQVTDKK
610 620 630 640 650 660
QASGSPEQKI RAGSREPVED PQSGSSGKQN KVEEDGPTEG PTDILDQNSP QCEDREISPV
670 680 690 700 710 720
GEKGPQCDTS QIGSEEGHVT SQHGGQAVEN HNLDNSDLSG QLEGFNSESG
GQAREEVGNS
KSKEDCTMS
SEQ ID NO: 2
There are several amino acid modifications within the protein. Amino acids 16, 83, 84,
88, 92, 302, 501 , 614 and 658 are phosphoserine residues and amino acids 9 1 and 239
are phosphothreonine residues.
Three isoforms have been reported which are produced by alternative splicing: Isoform
1 (identifier: Q3UZ39-1 ) as represented by SEQ ID NO: 2, isoform 2 (identifier:
Q3UZ39-2) which differs from isoform 1 in that
amino acid 5 1 (E) is replaced by
EIYQVQKKYYGLDTKWGDIEQWMEDSERYSRRFRRNTSASDEDERLSVG
SRGSLRTNGYDGDYCGSQSLSRRSGRGLSCSNLGLPSSGLASKPLSTQN
GSRASMLDESSLYGARRGSACGSRAPSEYGSHLNSSSRASSRASSARAS
PV SEQ ID NO:3
amino acid 104 (I) is replaced by
IKELNELKDQIQDVEGKYMQGLKEM SEQ ID NO: 4
amino acid 193 (E) is replaced by
EEIRQLQQKQAGFIREISDLQETIEWKDKKIGALERQKEFFDSIRSERDDLRE
ETVKLKEELK SEQ ID NO: 5
amino acids 241 -394 (GKA...IDK) are replaced by
DVRLKKLIDERECLLEQIKKLKGQLEGRQKNNKLDLLRAEDGILENGTDAHV
MDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYRSAAENAEKI
EDELKAEKRKLQRELRSALDKTEELEVSNGHLVKRLEKMKANRSALLSQQSEQ ID NO
and amino acids 395-729 are missing.
Isoform 3 (identifier: Q3UZ39-3) differs from isoform 1 in that amino acids 1-239 are
missing and amino acid 240 (L) has been replaced by M.
There is also known a further isoform of the Lrrfipl protein which is available under the
accession number NP_001 104782.1 from the NCBI (National Centre for Biotechnology
Information; National Library of Medicine 38A, Bethesda, MD20894, USA;
www.ncbi.nih.gov; corresponding nucleic acid sequence: NM_001 1113 12.1 ) . This
isoform was identified in the Examples and is therefore preferred for mouse.
Furthermore, in the following species variants are exemplified:
Organism Human NCBI accessions
Similarity
cow 75.28 (nucleic acid) XM 8691 63.2
(Bos taurus) 66.93 (amino acid) XP_874256.2
rat 70.1 7 (nucleic acid ) NM 001 014269.1
(Rattus norvegicus) 60.36 (amino acid) NP_001 0 14291 .1
Af can clawed frog 74.5 (nucleic acid ) CD301 18 1.1
(Xenopus laevis)
Accordingly, the term Lrrfipl also encompasses naturally occurring variants.
Non-naturally occurring variants may be obtained by a limited number of amino acid
deletions, insertions and/or substitutions, particularly deletions, insertions and/or
substitutions of at most 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid(s).
It should be noted that the Lrrfipl variant of the present invention is a functionally active
variant, in that the variant maintains its biological function, e.g. its involvement in pain
(e.g. as manifestation of the pain phenotype "mechanic hyperalgesia") or complement
classical pathway. Preferably, maintenance of biological function is defined as having at
least 50 %, preferably at least 60 %, more preferably at least 70 %, 80 % or 90 %, still
more preferably 95 % of the activity of the natural occurring Lrrfipl . The biological
activity may be determined as known to the skilled person. For example, the
manifestation of the pain phenotype "mechanic hyperalgesia" can be determined as
detailed in the Examples and in Persson et al., 2009, Molecular Pain 5:7.
The variant may be modified in order to comprise a further component. Accordingly, the
variant may be a molecule having a domain composed of a naturally occurring Lrrfipl
protein or a variant thereof as detailed herein and at least one further component. In
one preferred embodiment variant may be a fusion protein comprising (i) a Lrrfipl
protein or functionally active variant and (ii) a further protein component. For example,
the protein may be coupled to a marker, such as a tag used for purification purposes
(e.g. 6 His (or HexaHis) tag, Strep tag, HA tag, c-myc tag or glutathione S-transferase
(GST) tag). If e.g. a highly purified Lrrfipl protein or variant should be required, double
or multiple markers (e.g. combinations of the above markers or tags) may be used. In
this case the proteins are purified in two or more separation chromatography steps, in
each case utilizing the affinity of a first and then of a second tag. Examples of such
double or tandem tags are the GST-His-tag (glutathione-S-transferase fused to a
polyhistidine-tag), the 6xHis-Strep-tag (6 histidine residues fused to a Strep-tag), the
6xHis-tag1 00-tag (6 histidine residues fused to a 12-amino-acid protein of mammalian
MAP-kinase 2), 8xHis-HA-tag (8 histidine residues fused to a haemagglutinin-epitopetag),
His-MBP (His-tag fused to a maltose-binding protein, FLAG-HA-tag (FLAG-tag
fused to a hemagglutinin-epitope-tag), and the FLAG-Strep-tag. The marker could be
used in order to detect the tagged protein, wherein specific antibodies could be used.
Suitable antibodies include anti-HA (such as 12CA5 or 3F1 0), anti-6 His, anti-c-myc and
anti-GST. Furthermore, the Lrrfipl protein could be linked to a marker of a different
category, such as a fluorescence marker or a radioactive marker, which allows for the
detection of Lrrfipl . In a further embodiment, Lrrfipl could be part of a fusion protein,
wherein the second part could be used for detection, such as a protein component
having enzymatic activity.
In another embodiment of the present invention, the Lrrfipl variant could be a Lrrfipl
fragment, wherein the fragment is still functionally active. This may include Lrrfipl
proteins with short internal and/or C- and/or N-terminal deletions (e.g. deletions of at
most 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6 5, 4, 3, 2, or 1 amino acid).
Additionally, the Lrrfipl fragment may be further modified as detailed above for the
Lrrfipl protein.
Alternatively or additionally, the Lrrfipl protein or variant thereof as described above
may comprise one or more amino acid substitution(s). However, semi-conservative and
especially conservative amino acid substitutions, wherein an amino acid is substituted
with a chemically related amino acid are preferred. Typical substitutions are among the
aliphatic amino acids, among the amino acids having aliphatic hydroxyl side chain,
among the amino acids having acidic residues, among the amide derivatives, among
the amino acids with basic residues, or the amino acids having aromatic residues.
Typical semi-conservative and conservative substitutions are:
Amino acid Conservative substitution Semi-conservative substitution
A G; S; T N; V; C
C A; V; L M; I; F; G
D E; N; Q A; S; T; K; R; H
E D; Q; N A; S; T; K; R; H
F W; Y; L; M; H ; V; A
G A S; N; T; D; E; N; Q
H Y; F; K; R L; M; A
V; L; M; A F; Y; W; G
K R; H D; E; N; Q; S; T; A
L M; I; V; A F; Y; W; H; C
M L; I; V; A F; Y; W; C;
N Q D; E; S; T; A; G; K; R
P V; I L; A; M; W; Y; S; T; C; F
Q N D; E; A; S; T; L; M; K; R
R K; H N; Q S; T; D; E; A
S A; T; G; N D; E; R; K
T A; S; G; N; V D; E; R; K; l
V A; L; l M; T : C; N
w F; Y; H L; M; ; V; C
Y F; W; H L; M; ; V; C
Changing from A, F, H, I, L, M, P, V, W or Y to C is semi-conservative if the new
cysteine remains as a free thiol. Furthermore, the skilled person will appreciate that
glycines at sterically demanding positions should not be substituted and that P should
not be introduced into parts of the protein which have an alpha-helical or a beta-sheet
structure.
The Lrrfipl protein or fragment or variant with substitution may be modified as detailed
above for the Lrrfipl protein or fragment or variant. In the following description of the
invention all details given with respect to Lrrfipl protein also relate to functionally active
variants thereof, unless stated otherwise.
It is noted that the above modifications of the Lrrfipl protein may be combined. The
variant of the present invention may be e.g. fragment of Lrrfipl having a marker fused to
it, or a Lrrfipl protein fragment comprising one or more amino acid substitutions.
However, most preferably, the Lrrfipl protein is a naturally occurring Lrrfipl protein as
detailed above, still more preferably, a naturally occurring human Lrrfipl protein (e.g.
SEQ ID NO: 1) .
The term Lrrfipl nucleic acids encompasses nucleic acids coding for the above Lrrfipl
protein as well as naturally occurring and non-naturally occurring variants thereof (as
defined herein). Preferably, the term relates to coding or non-coding regions of the
Lrrfipl gene, wherein these sections are of a relevant size in order to be specific for that
gene. Examples of those regions are introns, exons or regulatory elements such as a
Lrrfipl promoter.
The most preferred Lrrfipl nucleic acids code for the naturally occurring Lrrfipl protein
as detailed above, still more preferably, a naturally occurring human Lrrfipl protein (e.g.
SEQ ID NO: 1) . The nucleic acid may be any macronnolecule composed of chains of
monomeric nucleotides carrying genetic information or form structures within cells. The
most common (and therefore preferred) nucleic acids are deoxyribonucleic acid (DNA)
and ribonucleic acid (RNA). Most preferably, the term Lrrfipl nucleic acids relates to
Lrrfipl gene, promoter, DNA, cDNA o mRNA.
Artificial nucleic acids include peptide nucleic acid (PNA), morpholino and locked
nucleic acid (LNA), as well as glycol nucleic acid (GNA) and threose nucleic acid (TNA).
Each of these is distinguished from naturally-occurring DNA or RNA by changes to the
backbone of the molecule.
In a second step of the method of the present invention the test system comprising a
Lrrfipl nucleic acid or protein or a functionally active variant thereof is contacted with an
agent or test compound for a time and under conditions suitable for having an effect on
the test system and detecting the same.
Suitable conditions include appropriate temperature and solution to avoid e.g.
denaturation of proteins involved or to maintain viable cells, if present. Suitable
conditions will depend from the particular test system chosen and the skilled person will
be able to select the same based on his general knowledge. Incubation steps can vary
from about 5 seconds to several hours, preferably from about 5 minutes to about 24
hours. However, the incubation time will depend upon the assay format, marker, volume
of solution, concentrations and the like. Usually, the assays will be carried out at
ambient temperature, although they can be conducted over a range of temperatures,
such as 10° C to 40° C.
The agent tested with the test system of the present invention may be any test
substance or test compound of any chemical nature. It may already be known as a drug
or medicament for a disease. Alternatively, it may be a known chemical compound not
yet known to have a therapeutic effect in another embodiment and the compound may
be a novel or so far unknown chemical compound. The agent may be also a mixture of
test substances or test compounds.
In one embodiment of the screening method of the present invention, the test substance
is provided in form of a chemical compound library. Chemical compound libraries
include a plurality of chemical compounds and have been assembled from any of
multiple sources, including chemical synthesized molecules or natural products, or have
been generated by combinatorial chemistry techniques. They are especially suitable for
high-throughput screening and may be comprised of chemical compounds of a
particular structure or compounds of a particular organism such as a plant. In the
context of the present invention, the chemical compound library is preferably a library
comprising proteins and polypeptides or small organic molecules. Preferably a small
organic molecule is less than 500 daltons in size, particularly a soluble, non-oligomeric,
organic compound.
In a third step of the method of the present invention, the effect of the test compound on
the test system is detected. In the following, a series of different detection systems will
be described in more detail. However, it should be understood that these are exemplary
and other test systems and methods may be also appropriate.
If the test compound has a specific and significant effect on the test system, the test
compound is identified as compound involved in pain. For this, the effect of the test
compound is compared to a control, particularly a negative control.
Controls are a part of the test methods, since they can eliminate or minimize unintended
influences (such as background signals). Controlled experiments are used to investigate
the effect of a variable on a particular system. In a controlled experiment one set of
samples have been (or is believed to be) modified and the other set of samples are
either expected to show no change (negative control) or expected to show a definite
change (positive control). The control can be determined in one test run together with
the test substance. It can be determined before of after determining the effect of the test
compound or it may be a known value.
The test compound having an effect on the test system may result in changing,
increasing or decreasing, the test system's signal. In the context of the present
invention, the test compound has an effect in comparison to a control, if the test system
contacted with the test compound produces a signal significantly lower or higher than
that of a control (e.g. test system not contacted with the test compound). The person
skilled in the art knows statistical procedures to assess whether two values are
significantly different from each other such as Student's t-test or chi-square tests.
Furthermore, the skilled person knows how to select a suitable control.
In a preferred embodiment, the signal of the test system is altered by the test compound
by at least 10 %, preferably at least 25 %, more preferably at least 50 %, still more
preferably at least 75 % and most preferably at least 90 % of the control, either positive
or negative.
For the method of the invention any suitable method of detecting may be used. Suitable
methods may be chosen depending from the characteristics of the test system and
agents to be tested.
The method may be a heterogeneous or homogeneous assay. As used herein, a
heterogeneous assay is an assay which includes one or more washing steps, whereas
in a homogeneous assay such washing steps are not necessary. The reagents and
compounds are only mixed and measured.
The test method may be either a continuous assay or a discontinuous assay.
Continuous assays give the rate of reaction with no further work necessary. There are
many different types of continuous assays. In spectrophotometer assays, the course of
the reaction is followed by measuring a change in absorbance. Fluorescence is when a
molecule emits light of one wavelength after absorbing light of a different wavelength.
Fluorometric assays use a difference in the fluorescence of substrate from product to
measure the enzyme reaction. These assays are in general much more sensitive than
spectrophotometric assays, but can suffer from interference caused by impurities and
the instability of many fluorescent compounds when exposed to light. Calorimetry is the
measurement of the heat released or absorbed by chemical reactions. These assays
are very general, since many reactions involve some change in heat and with use of a
microcalorimeter, not much enzyme or substrate is required. These assays can be used
to measure reactions that are impossible to assay in any other way.
Chemiluminescence is the emission of light by a chemical reaction. Some enzyme
reactions produce light and this can be measured to detect product formation. These
types of assay can be extremely sensitive, since the light produced can be captured by
photographic film over days or weeks, but can be hard to quantify, because not all the
light released by a reaction will be detected. Static Light Scattering measures the
product of weight-averaged molar mass and concentration of macromolecules in
solution. Given a fixed total concentration of one or more species over the
measurement time, the scattering signal is a direct measure of the weight-averaged
molar mass of the solution, which will vary as complexes form or dissociate. Hence the
measurement quantifies the stoichiometry of the complexes as well as kinetics. Light
scattering assays of protein kinetics is a very general technique that does not require an
enzyme.
Discontinuous assays are when samples are taken from an enzyme reaction at intervals
and the amount of product production or substrate consumption is measured in these
samples. Radiometric assays measure the incorporation of radioactivity into substrates
or its release from substrates. The radioactive isotopes most frequently used in these
assays are 14C, 32P, 35S and 125 l . Since radioactive isotopes can allow the specific
labeling of a single atom of a substrate, these assays are both extremely sensitive and
specific. They are frequently used in biochemistry and are often the only way of
measuring a specific reaction in crude extracts. Chromatographic assays measure
product formation by separating the reaction mixture into its components by
chromatography. This is usually done by high-performance liquid chromatography
(HPLC), but can also use the simpler technique of thin layer chromatography. Although
this approach can need a lot of material, its sensitivity can be increased by labeling the
substrates/products with a radioactive or fluorescent tag.
In accordance with the present invention the effect of the test compound may be by
interaction with a Lrrfipl nucleic acid or protein. Accordingly, the interaction/binding of
test compound to the Lrrfipl nucleic acid or protein could be determined by detecting
the complex of (i) the Lrrfipl nucleic acid or protein and (ii) the test compound. Suitable
methods of detecting complexes of two or more components are detailed below.
Alternatively, the effect, e.g. binding, of the test compound and the influence Lrrfipl
nucleic acid or protein could be detected indirectly. For this, the effect downstream the
Lrrfipl nucleic acid or protein could be detected. For example, the effect on the
transcription and translation related to Lrrfipl could be determined. In one embodiment,
the amount of Lrrfipl mRNA or Lrrfipl protein is detected.
Many known methods for detection that are designed to measure the presence or
quantity of specific proteins or other nucleic acids depend on the use of tags, markers or
labels. A component of the test system or the test compound may be labeled in a
variety of ways to allow sufficient detection or purification. In one preferred embodiment
a detectable marker is used in order to detect an effect on the test system. For this, (i)
the nucleic acid or Lrrfipl protein, (ii) the test compound and/or (iii) a further component
of the test system may be labeled with at least one detectable marker.
Common labeling methods may be used for labeling of one or more functional groups of
the component. For a protein, these could be for example the primary amino groups,
present at the N-terminal of each polypeptide chain and the side chain of lysine
residues; sulphhydryl groups, present on cysteine residues made available by treating
disulphide bonds with reducing agent or by modifying lysine residues with a reagent
such as succinimidyl-S-acetylthioacetate (SATA); or carbohydrate groups, usually
present in the Fc region of antibodies, which may be oxidized to create active aldehydes
for coupling. The component or compound may be labeled with a series of different
agents, such as biotin (for avidine-biotin chemistry), enzymes, activated fluorescent
dyes for labeling amines, sulphhydryls or other functional groups with e.g. FITC,
fluorescein, rhodamine, Cy dyes or Alexa fluos. Radioactive label such as 3H, 32P, 35S,
125 l or 14C as well as common enzyme labels including penicillinase, horseradish
peroxidase and alkaline phosphatase may be used as well.
In an embodiment of the present invention the marker is a radiolabel, particularly 3H, 32P,
33P, 35S, 125 l , or 14C.
In another embodiment the marker is one or more fluorescence marker(s). Suitable
fluorescence markers are described in the context of the methods of the present
invention.
Particularly useful in these methods is the use of target-specific probes that are
detectable via that chemical tags, markers or labels. Antibodies are the most common
type of probe; their binding affinities for particular antigens enable those targets to be
"found" and detected in a complex sample. However, antibodies are themselves
proteins, and they are not specifically detectable in an assay system unless they are
labeled for visualization or secondarily probed with another molecule that is labeled.
A marker (or tag or label) is any kind of substance which is able to indicate the presence
of another substance or complex of substances. The marker can be a substance that is
linked to or introduced in the substance to be detected. Detectable markers are used in
molecular biology and biotechnology to detect e.g. a protein, a product of an enzymatic
reaction, a second messenger, DNA, interactions of molecules etc. Examples of
suitable marker or labels include a fluorophore, a chromophore, a radiolabel, a metal
colloid, an enzyme, or a chemiluminescent or bioluminescent molecule. Examples of
fluorophores include fluorescein, rodamine, and sulfoindocyanine dye Cy5. Examples of
radiolabels include 3H, 14C, 32P, 33P, 35S, 99mTc or 125 l . Examples of enzymes include
horseradish peroxidase, alkaline phosphatase, glucose oxidase, and urease. Further
examples and preferred embodiments are detailed herein.
Different types of chemical labels or tags can be conjugated to secondary or primary
antibodies and other molecules to facilitate their visualization (i.e., detection and
measurement) by various methods. Radioisotopes were used extensively in the past,
but they are expensive, have a short shelf-life, offer no improvement in signal:noise ratio
and require special handling and disposal. Enzymes and fluorophores have largely
replaced radioactive isotopes as detectable tags for assays. A number of advancements
in reagents and instrumentation make these newer technologies more versatile and
powerful. Enzymatic tags such as horseradish peroxidase (HRP) are most commonly
used for blotting, immunoassays and immunohistochemistry methods. Fluorescent tags
are used predominately for cellular imaging, nucleic acid amplification and sequencing
and microarrays; however, fluorescence technology is developing rapidly for application
in all types of assays.
The detection of protein often involves the use of specific antibodies. Accordingly, the
detection of Lrrfipl protein or a variant thereof may include a specific Lrrfipl antibody.
Antibodies against Lrrfipl are available from commercial suppliers (e.g. catalog No: sc-
66677 or sc-66677 P from Santa Cruz Biotechnology, Inc., Santa Cruz, CA, USA; or
catalog No: ab77598 from Abeam Inc., Cambridge, MA, USA). Alternatively, antibodies
can be raised using well established techniques for immunizing animals with prepared
forms of the antigen. A variety of reagents is available to assist in antibody production
and purification, and various companies specialize in antibody production services.
Depending on the application to be performed, different levels of purity and types of
specificity are needed in a supplied primary antibody. To name just a few parameters,
antibodies may be monoclonal or polyclonal, supplied as antiserum or affinity-purified
solution, and validated for native protein or denatured protein detection.
An antibody that recognizes the target antigen, here Lrrfipl or fragment thereof, is
called the "primary antibody." If this antibody is labeled with a tag, direct detection of the
antigen is possible. Usually, however, the primary antibody is not labeled for direct
detection. Instead a "secondary antibody" that has been labeled with a detectable tag is
applied in a second step to probe for the primary antibody, which is bound to the target
antigen. Thus, the antigen is detected indirectly. Another form of indirect detection
involves using a primary or secondary antibody that is labeled with an affinity tag such
as biotin. Then a secondary (or tertiary) probe, such as streptavidin that is labeled with
the detectable enzyme or fluorophore tag, can be used to probe for the biotin tag to
yield a detectable signal. Several variants of these probing and detection strategies
exist. However, each one depends on a specific probe (e.g., a primary antibody) whose
presence is linked directly or indirectly to some sort of measurable tag (e.g., an enzyme
whose activity can produce a colored product upon reaction with its substrate).
Usually, a primary antibody without a detectable label and some sort of secondary
(indirect) detection method is required in assay methods. Nevertheless, nearly any
antibody can be labeled with biotin, HRP enzyme or one of several fluorophores if
needed. Most primary antibodies are produced in mouse, rabbit or one of several other
species. Nearly all of these are antibodies of the IgG class. Therefore, it is relatively
easy and economical for manufacturers to produce and supply ready-to-use, labeled
secondary antibodies for most applications and detection systems. Even so, several
hundred options are available, differing in the level of purity, IgG- and species-specificity,
and detection label. The choice of secondary antibody depends upon the species of
animal in which the primary antibody was raised (the host species). For example, if the
primary antibody is a mouse monoclonal antibody then the secondary antibody must be
an anti-mouse antibody obtained from a host other than the mouse.
With biotin-binding proteins as probes, the highly specific affinity interaction between
biotin and avidin or streptavidin protein is the basis for many kinds of detection and
affinity-purification methods. Biotin is very small (244 Daltons), so its covalent
attachment to antibodies or other probes rarely interferes with their functions. Yet its
presence as a label on a probe allows efficient and specific secondary detection with
either avidin or streptavidin. Both kinds of biotin-binding proteins are available in purified
forms labeled with enzymatic or fluorescent tags that enable detection in many kinds of
assays systems.
Enzymatic labels are most commonly used as secondary antibody (or streptavidin) tags
for detection in blotting and immunoassays. Enzymes provide detectable signal via their
activity; reaction with a specific substrate chemical yields a colored, light-emitting, or
fluorescent product. While reporter enzymes like beta-galactosidase and luciferase
have been successfully used to make probes, alkaline phosphatase (AP) and
horseradish peroxidase (HRP) are the two enzymes used most extensively as labels for
protein detection. An array of chromogenic, fluorogenic and chemiluminescent
substrates is available for use with either enzyme.
Alkaline phosphatase, usually isolated from calf intestine, is a large (140 kDa) protein
that catalyzes the hydrolysis of phosphate groups from a substrate molecule resulting in
a colored or fluorescent product or the release of light as a byproduct of the reaction.
AP has optimal enzymatic activity at a basic pH (pH 8-1 0) and can be inhibited by
cyanides, arsenate, inorganic phosphate and divalent cation chelators, such as EDTA.
As a label for Western blotting, AP offers a distinct advantage over other enzymes.
Because its reaction rate remains linear, detection sensitivity can be improved by simply
allowing a reaction to proceed for a longer time period.
Horseradish peroxidase is a 40 kDa protein that catalyzes the oxidation of substrates by
hydrogen peroxide, resulting in a colored or fluorescent product or the release of light as
a byproduct of the reaction. HRP functions optimally at a near-neutral pH and can be
inhibited by cyanides, sulfides and azides. Antibody-HRP conjugates are superior to
antibody-AP conjugates with respect to the specific activities of both the enzyme and
antibody. In addition, its high turnover rate, good stability, low cost and wide availability
of substrates makes HRP the enzyme of choice for most applications. Because of the
small size of the HRP enzyme, further increases in sensitivity may be achieved by using
poly-HRP conjugated secondary antibodies and may eliminate the need for using ABC
type amplification systems for some researchers.
Fluorescent Labels for Detection were historically used in a small number of cell biology
applications such as flow cytometry (FC), fluorescence-activated cell sorting (FACS)
and immunohistochemistry (IHC) using fluorescence microscopy. Until recently, the two
most common fluorophores for labeling probes were fluorescein (fluorescein
isothiocyanate, FITC) and rhodamine (tetramethyl rhodamine isothiocyanate, TRITC).
Other labels include fluorescent proteins such as the various forms of green fluorescent
protein (GFP) and the phycobiliproteins (allophycocyanin, phycocyanin, phycoerythrin
and phycoerythrocyanin). While having the ability to produce an intense fluorescent
signal for detection, fluorescent proteins can be difficult to optimize for conjugation
purposes and may create steric hindrance or background signal issues in binding
assays.
The use of fluorophore-conjugated probes in blotting and immunoassays requires fewer
steps compared to the use of enzymatic labels because there is no substrate
development step to perform. While the protocol is shorter, fluorescent detection
requires special equipment and the sensitivity is not a high as that which can be
obtained with enzymatic chemiluminescent systems. Although not as sensitive as
enzymatic detection, fluorescent detection methods reduce chemical waste and have
the added advantage of multiplex compatibility (using more than one fluorophore in the
same experiment).
Alternatively or additionally, two markers may be used in order to detect proximity of two
substances, e.g. the test compound or the known Lrrfipl ligand and the Lrrfipl protein.
The markers may be, e.g. one radioactive or fluorescent marker and one scintillator (e.g.
for a scintillation proximity assay) or two fluorescent markers may be used (e.g. for
FRET). In one example the Lrrfipl protein and the test substance could be labeled with
a first and a second marker. In case the test substance is bound to the protein, and the
labels are therefore in close proximity, energy could be transferred from the first to the
second label, thus detecting the interacting of Lrrfipl protein and test substance. This
test could be designed as a competition binding test, wherein a known Lrrfipl ligand
carries one of the labels.
Examples of suitable marker combinations include
- radiolabels 3H, 33P, 35S or 14C, 125 l combined with scintillator such as Yttrium silicate
or polyvinyl-toluene, e.g. compartmented in a microparticle or
- a donor fluorescent markers such as fluorescein, Lucifer Yellow, B-phycoerythrin, 9-
acridineisothiocyanate, Lucifer Yellow VS, 4-acetamido-4'-isothiocyanatostilbene-
2,2'-disulfonic acid, 7-diethylamino-3-(4'-isothiocyanatophenyl)-4-methylcoumarin,
succinimdyl 1-pyrenebutyrate, and 4-acetamido-4'-isothiocyanatostilbene-2,2'-
disulfonic acid derivatives combined with a acceptor fluorescent marker such as LCRed
610, LC -Red 640, LC-Red 670, LC -Red 705, Cy5, Cy5.5, Lissamine
rhodamine B sulfonyl chloride, tetramethyl rhodamine isothiocyanate, rhodamine x
isothiocyanate, erythrosine isothiocyanate, fluorescein, diethylenetriamine
pentaacetate or other chelates of Lanthanide ions (e.g., Europium, or Terbium).
As an alternative to the detection by antibodies the method of the invention could be
designed as a competition binding experiment, in which the displacement of the binding
of a known Lrrfipl ligand from Lrrfipl by a test substance is studied. Successful
displacement of the known ligand from the protein is an indicator for binding of the test
substance to the protein. In this approach, it is advantageously to label the known
Lrrfipl ligand which allows for convenient testing of multiple test compounds (e.g. of a
library), whereby not each of the test compounds needs to be labeled.
A ligand is a substance that is able to bind to and form a complex with a biomolecule,
herein e.g. Lrrfipl protein or nucleic acid. It is a molecule binding to a site on the
biomolecule, by intermolecular forces such as ionic bonds, hydrogen bonds and Van
der Waals forces. The docking (association) is usually reversible (dissociation). Actual
irreversible covalent binding between a ligand and its target molecule is rare in
biological systems. Ligand binding to a biomolecule may alter its activity, e.g. its ability
to activate downstream signal transduction. Ligands include inhibitors and activators.
Inhibitors are molecules that bind to enzymes and decrease their activity. Since blocking
an enzyme's activity can correct a metabolic imbalance, many drugs are enzyme
inhibitors. Not all molecules that bind to enzymes are inhibitors; enzyme activators bind
to enzymes and increase their enzymatic activity.
The binding of an inhibitor can stop a binding partner from interacting with the
biomolecule and/or hinder the biomolecule from being active or activated. Inhibitor
binding is either reversible or irreversible. Irreversible inhibitors usually react with the
biomolecule and change it chemically. These inhibitors may e.g. modify key amino acid
residues needed for the activity. In contrast, reversible inhibitors bind non-covalently
and different types of inhibition are produced depending on whether these inhibitors
bind the biomolecule.
Selective ligands have a tendency to bind to very limited types of targets (biomolecules)
such as enzymes, while non-selective ligands bind to several types of targets. This
plays an important role in pharmacology, where drugs that are non-selective tend to
have more adverse effects, because they bind to several other biomolecules in addition
to the one generating the desired effect.
For competition binding experiments a known ligand is labeled with at least one
detectable marker and added to the incubation step of b). After step b) bound labeled
ligand is separated from non-bound ligand. The separation may be done by a common
separation step such as filtration, centrifugation, immobilization, phase separation and
removal of liquids etc. The amount of signal provided by the label is indicative for the
amount of ligand bound and therefore also for the amount of test compound bound to
the biomolecule, as ligand and test compound compete for the binding to the
biomolecule.
In an embodiment the assay for detection the effect of the test compound is an SPA
(scintillation proximity assay), a FRET (fluorescence resonance energy transfer) assay,
TR-FRET (time-resolved fluorescence resonance energy transfer) assay or a FP
(fluorescence polarisation) assay.
SPA (scintillation proximity assay) is a type of technology that is used for biochemical
screening which permits the rapid and sensitive measurement of a broad range of
processes biologically in a homogeneous system. The type of beads that is involved in
the SPA are microscopic in size and within the beads itself, there is a scintillant which
emits light when it is stimulated. Stimulation occurs when radio-labeled molecules
interact with the bead. This interaction will trigger the bead to emit light, which can be
detected using scintillation counters.
In more detail, when the radio-labeled molecule is attached or is in close proximity to
bead, light emission is stimulated. However, if the bead remains unbounded by the
radio-labeled molecule, the bead will not be stimulated to emit light. This is due to the
fact that the energy released from the unbounded radioactivity is too dissolute when it is
too far from the SPA bead, hence the beads not being stimulated to produce a signal.
Tritium is highly recommended as it suits SPA very well. It is due to the 1.5 path
length through water, which is very short. So, when the -particle is within that particular
range of 1.5 with the scintillant bead, there is sufficient energy to stimulate the
scintillant bead to emit light. If the distance between the greater than 1.5 , then the -
particle is incapable of traveling the required distance to stimulate the bead as there is
insufficient energy. There is also an assortment of bead coatings available that allows
this method to be applied to a broad range of applications, such as enzyme assays and
radio-immuno assays.
Fluorescence resonance energy transfer (FRET) describes a radiation -free energy
transfer between two chromophores. A donor chromophore in its excited state can
transfer energy by a non-radiative long-range dipole-dipole coupling mechanism to an
acceptor fluorophore in close proximity (typically < 10 nm). As both molecules are
fluorescent, the energy transfer is often referred to as "fluorescence resonance energy
transfer", although the energy is not actually transferred by fluorescence. FRET is a
useful tool to detect and quantify protein-agent interactions, protein-protein interactions,
protein-DNA interactions, and protein-conformational changes. For monitoring binding
of a protein to an agent, one protein to another or a protein to DNA, one of the
molecules is labeled with a donor and the other with an acceptor and these fluorophorelabeled
molecules are mixed. When they are present in an unbound state, donor
emission is detected upon donor excitation. Upon binding of the molecules, the donor
and acceptor are brought in proximity and the acceptor emission is predominantly
observed because of the intermolecular FRET from the donor to the acceptor. Suitable
neighbors for FRET are known in the art and the skilled practitioner will be able to
choose a suitable combination of labels for both antibodies. As used herein with respect
to donor and corresponding acceptor, "corresponding" refers to an acceptor fluorescent
moiety having an emission spectrum that overlaps with the excitation spectrum of the
donor. However, both signals should be separable from each other. Accordingly, the
wavelength maximum of the emission spectrum of the acceptor should preferably be at
least 30 nm, more preferably at least 50 nm, such as at least 80 nm, at least 100 nm or
at least 150 nm greater than the wavelength maximum of the excitation spectrum of the
donor.
Representative donor fluorescent moieties that can be used with various acceptor
fluorescent moieties in FRET technology include fluorescein, Lucifer Yellow, B-phycoerythrin,
9-acridineisothiocyanate, Lucifer Yellow VS, 4-acetamido-4'-isothiocyanatostilbene-
2,2'-disulfonic acid, 7-diethylamino-3-(4'-isothiocyanatophenyl)-4-methylcoumarin,
succinimdyl 1-pyrenebutyrate, and 4-acetamido-4'-isothiocyanatostilbene-2,2'-disulfonic
acid derivatives. Representative acceptor fluorescent moieties, depending upon the
donor fluorescent moiety used, include LC-Red 6 10, LC -Red 640, LC-Red 670, LC -
Red 705, Cy5, Cy5.5, Lissamine rhodamine B sulfonyl chloride, tetramethyl rhodamine
isothiocyanate, rhodamine x isothiocyanate, erythrosine isothiocyanate, fluorescein,
diethylenetriamine pentaacetate or other chelates of Lanthanide ions (e.g., Europium, or
Terbium). Donor and acceptor fluorescent moieties can be obtained, for example, from
Molecular Probes (Junction City, OR) or Sigma Chemical Co. (St. Louis, MO).
Alternatively, time-resolved fluorescence resonance energy transfer (TR-FRET) may be
used for the test system of the present invention. TR-FRET unites TRF (time-resolved
fluorescence) and the FRET principle. This combination combines the low background
benefits of TRF and the homogeneous assay format of FRET. While FRET has already
been described above, TRF takes advantage of the unique properties of lanthanides or
any other donor with long half-life. Suitable donors for TR-FRET include, amongst
others, lanthanide chelates (cryptates) and some other metal ligand complexes, which
can have fluorescent half-life in the micro- to millisecond time range and which,
therefore, also allow the energy transfer to occur in micro- to millisecond measurements.
Fluorescence lanthanide chelates have been used as energy donors in the late
seventies. The commonly used lanthanides include samarium (Sm), europium (Eu),
terbium (Tb) and dysprosium (Dy). Because of their specific photophysical and spectral
properties, complexes of lanthanides are of major interest for fluorescence application in
biology. Specifically, they have a large stroke's shift and extremely long emission halflives
(from microseconds to milliseconds) when compared to more traditional
fluorophores.
Usually, organic chromophores are used as acceptors. These include allophycocyanin
(APC). Suitable details on TR-FRET as well as acceptors are described in
WO 98/1 5830.
Fluorescence polarisation (FP)-based assays are assays which use polarized light to
excite fluorescent substrate in solution. These fluorescent substrates are free in solution
and tumble, causing the emitted light to become depolarised. When the substrate binds
to a larger molecule, i.e. the acyl group, its tumbling rates are greatly decreased, and
the emitted light remains highly polarized.
Alternatively, mass spectrometry may be used. The term "mass spectrometry" refers to
the use of an ionization source to generate gas phase ions from a sample on a surface
and detecting the gas phase ions with a mass spectrometer. The term "laser desorption
mass spectrometry" refers to the use of a laser as an ionization source to generate gas
phase ions from a sample on a surface and detecting the gas phase ions with a mass
spectrometer. A preferred method of mass spectrometry for biomolecules such as
acylated acyl acceptor is matrix-assisted laser desorption/ionization mass spectrometry
or MALDI. In MALDI, the analyte is typically mixed with a matrix material that, upon
drying, co-crystallizes with the analyte. The matrix material absorbs energy from the
energy source which otherwise would fragment the labile biomolecules or analytes.
Another preferred method is surface-enhanced laser desorption/ionization mass
spectrometry or SELDI. In SELDI, the surface on which the analyte is applied plays an
active role in the analyte capture and/or desorption. In the context of the invention the
sample comprises a biological sample that may have undergone chromatographic or
other chemical processing and a suitable matrix substrate.
In mass spectrometry the "apparent molecular mass" refers to the molecular mass (in
Daltons)-to-charge value, m/z, of the detected ions. How the apparent molecular mass
is derived is dependent upon the type of mass spectrometer used. With a time-of-f light
mass spectrometer, the apparent molecular mass is a function of the time from
ionization to detection. The term "signal" refers to any response generated by a
biomolecule under investigation. For example, the term signal refers to the response
generated by a biomolecule hitting the detector of a mass spectrometer. The signal
intensity correlates with the amount or concentration of the biomolecule. The signal is
defined by two values: an apparent molecular mass value and an intensity value
generated as described. The mass value is an elemental characteristic of the
biomolecule, whereas the intensity value accords to a certain amount or concentration
of the biomolecule with the corresponding apparent molecular mass value. Thus, the
"signal" always refers to the properties of the biomolecule.
As detailed above, in a first aspect the method of identifying a compound involved in
pain, the method comprising the steps of:
a) providing a test system comprising Lrrfipl nucleic acid,
b) contacting the test system with a test compound, and
c) determining the effect of the test compound on the test system,
wherein the test compound is identified as a compound involved in pain, when a
significant effect of the test compound on the test system relative to a control is
detected.
The effect of the test compound on the nucleic acid may be determined on a variety of
expression or signal transduction levels.
The test compound could be designed to bind to a regulatory sequence of the Lrrfipl
gene or the Lrrfipl gene itself. Thereby, the test compound could have an influence on
the expression of the gene.
Accordingly, the binding of test compound to the regulatory sequence could be
determined by detecting the complex of (i) the regulatory sequence or gene and (ii) the
test compound. Suitable methods of detecting complexes of two or more components
are detailed herein.
The regulatory sequence is a segment of DNA where regulatory proteins such as
transcription factors bind preferentially. These regulatory proteins bind to short stretches
of DNA called regulatory regions, which are appropriately positioned in the genome,
usually a short distance 'upstream' of the gene being regulated. By doing so, these
regulatory proteins can recruit another protein complex, called the RNA polymerase. In
this way, they control gene expression. The regulatory sequence includes the promoter
region which usually works in concert with other regulatory regions (enhancers,
silencers, boundary elements/insulators) to direct the level of transcription of a given
gene.
Alternatively, the effect, e.g. binding, of the test compound and the influence on the
gene transcription could be detected indirectly. For this, the effect downstream the
Lrrfipl gene could be detected. For example, the effect on the transcription and
translation related to Lrrfipl could be determined. In one embodiment, the amount of
Lrrfipl mRNA or Lrrfipl protein is detected. Alternatively, the effect of binding to the GCrich
consensus sequence, on the expression of TNF, EGFR or PDGFA or on NFkappaB
signaling may be determined.
Suitable methods of detecting mRNA are described herein and include e.g. Northern
blot analysis, nuclease protection assays (NPA), in situ hybridization, and reverse
transcription-polymerase chain reaction (RT-PCR).
For the Northern blotting procedure, RNA samples may be first separated by size via
electrophoresis in an agarose gel under denaturing conditions. The RNA is then
transferred to a membrane, crosslinked and hybridized with a labeled probe.
Nonisotopic or high specific activity radiolabeled probes can be used including randomprimed,
nick-translated, or PCR-generated DNA probes, in vitro transcribed RNA probes,
and oligonucleotides. Additionally, sequences with only partial homology (e.g., cDNA
from a different species or genomic DNA fragments that might contain an exon) may be
used as probes.
The Nuclease Protection Assay (NPA) is an extremely sensitive method for the
detection and quantitation of specific mRNAs. The basis of the NPA is solution
hybridization of an antisense probe (radiolabeled or nonisotopic) to an RNA sample.
After hybridization, single-stranded, unhybridized probe and RNA are degraded by
nucleases. The remaining protected fragments are separated e.g. on an acrylamide gel.
Solution hybridization is typically more efficient than membrane-based hybridization,
and it can accommodate up to 100 g of sample RNA, compared with the 20-30 g
maximum of blot hybridizations. NPAs are also less sensitive to RNA sample
degradation than Northern analysis since cleavage is only detected in the region of
overlap with the probe (probes are usually about 100-400 bases in length).
In RT-PCR, an RNA template is copied into a complementary DNA (cDNA) using a
retroviral reverse transcriptase. The cDNA is then amplified exponentially by PCR.
Relative quantitative RT-PCR involves amplifying an internal control simultaneously with
the gene of interest. The internal control is used to normalize the samples. Once
normalized, direct comparisons of relative abundance of a specific mRNA can be made
across the samples. Competitive RT-PCR is used for absolute quantitation. This
technique involves designing, synthesizing, and accurately quantitating a competitor
RNA that can be distinguished from the endogenous target by a small difference in size
or sequence. Known amounts of the competitor RNA are added to experimental
samples and RT-PCR is performed. Signals from the endogenous target are compared
with signals from the competitor to determine the amount of target present in the sample.
The above methods may include nucleic acids labeling. A series of techniques are
known to the skilled person allowing for labeling of DNA, RNA or oligonuleotides. These
include for example Nick translational labeling, random primed DNA labeling, PCR
labeling of DNA probes and oligonucleotide 375' end labeling, transcriptional labeling of
RNA probes, oligonucleotide 375' end labeling and oligonucleotide tailing.
The nick translation method is based on the ability of DNase I to introduce randomly
distributed nicks into DNA. DNA polymerase I synthesizes DNA complementary to the
intact strand in a 5' 3' direction using the 3'-OH termini of the nick as a primer. The 5'
3' exonucleolytic activity of DNA Polymerase I simultaneously removes nucleotides in
the direction of synthesis. The polymerase activity sequentially replaces the removed
nucleotides with isotope-labeled or hapten-labeled deoxyribonucleoside triphosphates.
At low temperature ( 15°C), the unlabeled DNA in the reaction is thus replaced by newly
synthesized labeled DNA. Common labels include digoxigenin-, biotin-, or
fluorochromes such as fluorescein or tetramethylrhodamin.
The method of "random primed" DNA labeling is based on the hybridization of a mixture
of all possible hexanucleotides to the DNA to be labeled. All sequence combinations are
represented in the hexanucleotide primer mixture, which leads to binding of primer to
the template DNA in a statistic manner. Thus an equal degree of labeling along the
entire length of the template DNA is guaranteed. The complementary strand is
synthesized from the 3' OH termini of the random hexanucleotide primer using Klenow
enzyme, labeling grade. Modified deoxyribonucleoside triphosphates (e.g. [32P]-, [35S]-,
[3H]-, [125 l]-, digoxigenin- or biotin-labeled) present in the reaction are incorporated into
the newly synthesized complementary DNA strand.
The polymerase chain reaction (PCR) allows the amplification of minute amounts of
DNA. The only prerequisite is that some sequence information of the target sequence is
known for synthesizing the appropriate primers. The combination of labeling with PCR is
a powerful tool for the analysis of PCR products, and also for the preparation of labeled
probes from small amounts of a respective target sequence. For example digoxigenin, a
steroid hapten, may be used to label DNA, RNA, or oligonucleotides for hybridization,
and subsequent color- or luminescent detection. The digoxigenin is usually coupled to
dUTP via an alkali-labile ester bond. The labeled dUTP can be easily incorporated by
enzymatic nucleic-acid synthesis using DNA polymerases.
Oligonucleotides may enzymatically be labeled at their 3' -end with terminal transferase
either by incorporation of a label such as single digoxigenin-labeled dideoxyuridinetriphosphate
(DIG-ddUTP) or by the addition of a longer nucleotide tail. Terminal
Transferase catalyzes the template independent addition of deoxy- and
dideoxynudeoside triphosphates to the 3Ό ends of double and single-stranded DNA
fragments and oligonucleotides. Terminal transferase incorporates digoxigenin-, biotin-,
and fluorochrome-labeled deoxy- and dideoxynucleotides as well as radioactive labeled
deoxy-and dideoxynucleotides. Alternatively or additionally, oligonucleotides may be
labelled at the 5'-terminus, e.g. by reacting with a phosphoramidite in a final step
according to the classical solid phase phosphoramidite synthesis method. By this
process a 5' -terminal amino function is created. Treatment with ammonia releases the
oligonucleotide from the support and cleaves the protecting groups. In the subsequent
step the digoxigenin moiety is introduced at the 5' -position.
Different labels are known which may be used in the above labeling methods. Some of
them including their detection are exemplarily described in the following:
Biotin-labeled compounds can be detected for example by anti-biotin antibodies or by
streptavidin conjugates. Anti-biotin antibodies (e.g. monoclonal anti-biotin antibody or
Fab-fragment, conjugated with alkaline phosphatase (AP)) may be used in the detection
of biotin-labeled nucleic acids by enzyme immunoassay with luminescence on nylon
membranes. This method of detection may be employed for detection of biotin labeled
nucleic acids on membranes (e.g. Southern blots, dot blots), in cells and tissues (e.g. in
situ hybridization), immunoblotting, immunohistochemistry or ELISA. Streptavidin
conjugates are used for the detection of biotin-labeled substances {e.g., biotinylated
antibodies) which can be used for several immunological detection systems. For this,
streptavidin e.g. from Streptomyces avidinii could be coupled to alkaline phosphatase or
to -peroxidase. This method of detection may be employed with immunoblotting,
immunohistochemistry or ELISA.
Probe-target hybrids may be detected with an enzyme-linked immunoassay. This
immunochemical detection step is usually more sensitive than radioactive detection
procedures. In this assay, the membrane may be blocked to prevent non-specific
interaction of the antibody with the filter. Alkaline phosphatase-conjugated antibody,
specific for digoxigenin, recognizes the digoxigenein molecule on the labeled hybrid.
Addition of an alkaline phosphatase substrate allows the visualization of the hybrids.
For chemiluminescence detection, suitable substrates for alkaline phosphatase such as
disodium 3-(4-methoxyspiro { 1 ,2-dioxetane-3,2-(5-chloro)tricyclo [3.3.1 .1 3,7]decan}-4-
yl)phenyl phosphate or disodium 4-chloro-3-(methoxyspiro { 1 ,2-dioxetane-3,2-(5-
chloro)tricyclo [3.3.1 .1 3,7]decan}-4-yl)phenyl phosphate belong to the group of the
dioxetane phenyl phosphates. Upon dephosphorylation by alkaline phosphatase, an
intermediate is formed whose decomposition results in light emission which can be
recorded e.g. on X-ray film.
Colorimetric detection of DIG-labeled probes is usually performed with colorless
substrates which form a redox system. Examples are like 5-bromo-4-chloro-3-indolylphosphate
and 4-Nitro-blue-tetrazolium-chloride. 5-bromo-4-chloro-3-indolyl-phosphate
is oxidized by the alkaline phosphatase to indigo by release of a phosphate group. In
parallel, 4-Nitro-blue-tetrazolium-chloride is reduced to diformazan. The reaction
products form a water insoluble dark blue to brownish precipitate, depending on the
type of membrane.
Various reporter molecules can be coupled to detecting antibodies to visualize the
specific probe-target hybridization including, but not limited to, enzyme-coupled
antibodies, fluorochrome-labeled antibodies (detection by fluorescent microscope and
specific filters which allow visualization of the wavelength emitted by the fluorescent
dye) and antibodies coupled to colloidal gold (detection by electron microscope on
cryostatic sections).
Multiple simultaneous hybridizations can be performed by using combinations of
digoxigenin-, biotin- and fluorochrome-labeled probes to localize different chromosomal
regions or different RNA sequences in one preparation. Such multiprobe experiments
are made possible by the availability of different fluorescent dyes coupled to antibodies.
These include fluorescein or FITC (fluorescein isothiocyanate; yellow), rhodamine or
TRITC (tetramethylrhodamine isothiocyanate; red) and AMCA (amino-methylcoumarin
acetic acid; blue).
The effect on the regulatory sequence could also by detected by attaching the
regulators sequence to a reporter gene and introducing the resulting DNA construct into
a cell or organism. For bacteria or eukaryotic cells in culture, this is usually in the form
of a circular DNA molecule called a plasmid. It is important to use a reporter gene that is
not natively expressed in the cell or organism under study, since the expression of the
reporter is being used as a marker for successful uptake of the gene of interest.
Commonly used reporter genes that induce visually identifiable characteristics usually
involve fluorescent and luminescent proteins; examples include the gene that encodes
jellyfish green fluorescent protein (GFP), which causes cells that express it to glow
green under blue light, the enzyme luciferase, which catalyzes a reaction with luciferin
to produce light, and the red fluorescent protein from the gene dsRed. Another common
reporter in bacteria is the lacZ gene, which encodes the protein -galactosidase. This
enzyme causes bacteria expressing the gene to appear blue when grown on a medium
that contains the substrate analog X-gal (an inducer molecule such as IPTG is also
needed under the native promoter). An example of a selectable-marker reporter in
bacteria is the chloramphenicol acetyltransferase (CAT) gene, which confers resistance
to the antibiotic chloramphenicol. The influence of a test compound may be detected by
the determining the amount of the above signal relative to a control.
As detailed above, in a second aspect the method of identifying a compound involved in
pain, the method comprising the steps of:
a) providing a test system comprising Lrrfipl protein or a functionally active variant
thereof,
b) contacting the test system with a test compound, and
c) determining the effect of the test compound on the test system,
wherein the test compound is identified as a compound involved in pain, when a
significant effect of the test compound on the test system relative to a control is
detected.
Accordingly, the binding of test compound to the Lrrfipl protein or variant thereof could
be determined by detecting the complex of (i) the Lrrfipl protein or variant thereof and
(ii) the test compound. Suitable methods of detecting complexes of two or more
components are detailed above and in the following.
Suitable methods for detecting a protein are described herein and include e.g. detection
of a labeled protein (such as a fusion protein comprising a detectable marker, tag or
enzyme component), protein immunostaining, protein immunoprecipitation,
Immunoelectrophoresis, immunoblotting, Western blotting, spectrophotometry, enzyme
assays etc.. The method may require protein purification prior to the detection, which
could involve protein isolation (e.g. by chromatography methods, protein extraction,
protein solubilization, gel electrophoresis, and electrofocusing).
Protein immunostaining is an antibody-based method to detect a specific protein in a
sample. The term immunostaining was originally used to refer to the
immunohistochemical staining of tissue sections. Now however, immunostaining
encompasses a broad range of techniques used in histology, cell biology, and molecular
biology that utilize antibody-based staining methods. Immunohisto- or -cytochemistry of
tissue sections or cells which are preserved by fixation.
While the first cases of IHC staining used fluorescent dyes, other non-fluorescent
methods using enzymes such as peroxidase and alkaline phosphatase are now used
more often. These enzymes are capable of catalysing reactions that give a coloured
product that is easily detectable by light microscopy. Alternatively, radioactive elements
can be used as labels, and the immunoreaction can be visualized by autoradiography.
Tissue preparation or fixation is essential for the preservation of cell morphology and
tissue architecture. Inappropriate or prolonged fixation may significantly diminish the
antibody binding capability. Many antigens can be successfully demonstrated in
formalin-fixed paraffin-embedded tissue sections. Optimisation of fixation methods and
times, pre-treatment with blocking agents, incubating antibodies with high salt, and
optimising post-antibody wash buffers and wash times may be important for obtaining
high quality immunostaining.
Western blotting allows the detection of specific proteins (native or denatured) from
extracts made from cells or tissues, before or after any purification steps. Proteins are
generally separated by size using gel electrophoresis before being transferred to a
synthetic membrane (typically nitrocellulose or PVDF) via dry, semi-dry, or wet blotting
methods. The membrane can then be probed using antibodies using methods similar to
immunohistochemistry, but without a need for fixation. Detection is typically performed
using peroxidase linked antibodies to catalyse a chemiluminescent reaction. Western
blotting is a routine molecular biology method that can be used to semiquantitatively or
quantitatively compare protein levels between extracts. The size separation prior to
blotting allows the protein molecular weight to be gauged as compared with known
molecular weight markers. Western blotting is an analytical technique used to detect
specific proteins in a given sample of tissue homogenate or extract. It uses gel
electrophoresis to separate proteins by the length of the polypeptide (denaturing
conditions) or by the 3-D structure of the protein (native/ non-denaturing conditions).
The enzyme-linked immunosorbent assay or ELISA is a diagnostic method for
quantitatively or semi-quantitatively determining protein concentrations from blood
plasma, serum or cell/tissue extracts in a multi-well plate format (usually 96-wells per
plate). Broadly, proteins in solution are adsorbed to ELISA plates. Antibodies specific for
the protein of interest are used to probe the plate. Background is minimised by
optimising blocking and washing methods (as for IHC), and specificity is ensured via the
presence of positive and negative controls. Detection methods are usually colorimetric
or chemiluminescence based.
Electron microscopy or EM can be used to study the detailed microarchitecture of
tissues or cells. Immuno-EM allows the detection of specific proteins in ultrathin tissue
sections. Antibodies labelled with heavy metal particles (e.g. gold) can be directly
visualised using transmission electron microscopy. While powerful in detecting the sub
cellular localisation of a protein, immuno-EM can be technically challenging, expensive,
and require rigorous optimisation of tissue fixation and processing methods.
Alternatively, the effect, e.g. binding, of the test compound and the influence on the
Lrrfipl protein could be detected indirectly. For this, the effect downstream the Lrrfipl
protein could be detected. For example, the effect on the phenotype, e.g. the
manifestation of algesia phenotype, could be determined.
In a preferred embodiment of the present invention the compound involved in pain is a
cellular compound naturally participating in the signal transduction pathway of the
Lrrfipl gene and/or the Lrrfipl protein.
As detailed above, Lrrfipl acts as a transcriptional repressor which preferentially binds
to the GC-rich consensus sequence and has been suggested to regulate expression of
TNF, EGFR and PDGFA.
However, few details are known about the signal transduction pathway of Lrrfipl in pain.
Therefore, it would be desirable to identify components of the signal transduction
pathway. For this, cellular components, optionally suspected of being involved in the
signal transduction of Lrrfipl , could be detected. These could be additional targets for
medicaments involved in pain.
In a preferred embodiment of the present invention the compound involved in pain alters
signal transduction upstream or downstream the Lrrfipl protein. Additionally, or
alternatively, the compound involved in pain alters signal transduction upstream or
downstream the Lrrfipl gene, particularly wherein the compound alters expression of
the Lrrfipl gene.
As already detailed above, the effect may not only be determined on the level of Lrrfipl
protein or gene, but also on a signal transduction or expression level upstream or
downstream. Examples include the Lrrfipl gene level (upstream of the Lrrfipl protein),
the mRNA level (upstream of the Lrrfipl protein and downstream of the Lrrfipl gene),
the protein level (downstream of the Lrrfipl gene) and the phenotype level (downstream
of the Lrrfipl gene and protein).
In a preferred embodiment of the present invention the compound involved in pain binds
to a cellular compound naturally participating in the signal transduction pathway of the
Lrrfipl gene and/or the Lrrfipl protein, particularly wherein the compound involved in
pain binds to the Lrrfipl gene or the Lrrfipl protein, especially the Lrrfipl protein.
Evidently, the binding of a compound to a cellular compound naturally participating in
the signal transduction pathway of the Lrrfipl gene and/or the Lrrfipl protein has most
likely an effect on the signal transduction. Often, binding of an artificial compound to a
cellular compound naturally participating in the signal transduction pathway leads to
inhibition of the pathway. However, the artificial compound may be designed to activate
that pathway. In both cases, the binding has an effect on the pathway, so that it is likely
that pain sensitivity is altered.
In a preferred embodiment of the present invention the compound involved in pain
inhibits signal transduction upstream or downstream the Lrrfipl gene, particularly
wherein the compound inhibits expression of the Lrrfipl gene. In a preferred
embodiment of the present invention wherein the compound involved in pain inhibits
signal transduction upstream or downstream the Lrrfipl protein, particularly wherein the
compound binds to the Lrrfipl protein. Based on the results of the example, it is
expected that those compounds are capable of inhibiting or reducing pain. Therefore,
they are preferred.
In another preferred embodiment of the present invention the test system is in a cell,
such as an animal cell, particularly a mammalian cell, especially a human cell.
A cell-based system is advantageously, because it allows for easy amplification of the
test system by propagating the cells and cellular mechanisms, e.g. signal transduction
components downstream of insulin or downstream or upstream of Lrrfipl protein or
gene, as these may be used in order to detect a signal indicative for altered glucose
uptake of a cell.
Examples of cells suitable in the context of the present invention include without
limitation L6 cells, 3T3 adipocytes, HEK 293, 745-A, A-431 , atrial myocytes, BxPC3,
C5N, Caco-2, Capan-1 , CC531 , CFPAC, CHO, CHO K 1, COS-1 , COS-7, CV-1 , EAHY,
EAHY 926, F98, GH3, GP&envAM12, H-295 R, H-4-II-E, HACAT, HACAT A 13 1, HEK,
HEL, HeLa, Hep G2, High Five, Hs 766T, HT29, HUV-EC R24, HUV-EC-C, IEC 17, IEC
18, Jurkat, K 562, KARPAS-299, L 929, LIN 175, MAt-LYLU, MCF-7, MNEL, MRC-5,
MT4, N64, NCTC 2544, NDCK II, Neuro 2A, NIH 3T3, NT2/D1 , P19, primary neuronal
cells, primary dendritic cells, primary human myoblasts, primary keratinocytes, SF9, SKUT-
1, ST, SW 480, SWU-2 OS, U-373, U-937, and Y-1 . Other suitable cells are known
to the one of skill in the art.
Cells that are cultured directly from an animal or a person are known as primary cells.
With the exception of some cell lines derived from tumors, most primary cell cultures
have limited lifespan. After a certain number of population doublings cells undergo the
process of senescence and stop dividing, while generally retaining viability.
An established or immortalised cell line has acquired the ability to proliferate indefinitely
either through random mutation or deliberate modification, such as artificial expression
of the telomerase gene. There are numerous well established cell lines representative
of particular cell types and it is within the knowledge of the skilled person to select a
suitable cell line.
Accordingly, in a preferred embodiment of the invention the cell is a cell line. A cell line
is a population of cells propagated in culture that are derived from, and therefore
genetically identical to, a single common ancestor cell. Preferred cell lines are HEK 293
cells (primary human embryonic kidney), 3T3 cells (murine embryonic fibroblasts), CHO
cells (Chinese hamster ovary), COS-7 cells (African green monkey cell line), HeLa cells
(human epithelioid cervical carcinoma), JURKAT cells (human T-cell leukaemia), BHK
2 1 cell (hamster normal kidney, fibroblast), and MCF-7 cells (human breast cancer).
The cell or cell line may be genetically modified to include Lrrfipl or components
needed for detection of an effect. A particularly preferred cell line encompasses a gene
coding for Lrrfipl under the control of a known promoter system. The promoter system
may be controllable, e.g. inducible by a chemical, or constitutively active. Those
promoter systems are well known to the skilled person,
Alternatively, cell lysates (crude, fractionated or purified) may be used. Exemplary
methods for producing these are known to the skilled person and may include
fragmentation, centrifugation and resuspending.
In a preferred embodiment of the present invention the method is a high-through-put
screening method.
High-throughput screening (HTS) is a method for scientific experimentation especially
used in drug discovery and relevant to the fields of biology and chemistry. Using for
example robotics, data processing and control software, liquid handling devices, and
sensitive detectors, High-Throughput Screening or HTS allows a researcher to quickly
conduct thousands or even millions of biochemical, genetic or pharmacological tests.
Through this process one can rapidly identify active compounds, antibodies or genes
which modulate a particular biomolecular pathway.
Usually, HTS uses automation to run a screen of an assay against a library of candidate
compounds. Typical HTS screening libraries or "decks" can contain from 100,000 to
more than 2,000,000 compounds.
Most often, the key testing vessel of HTS is the multi-well plate or microplate. Modern
microplates for HTS generally have either 96, 384, 1536, or 3456 wells. These are all
multiples of 96, reflecting the original 96 well microplate with 8 x 12 9mm spaced wells.
Most of the wells contain experimentally useful matter, often an aqueous solution of
dimethyl sulfoxide (DMSO) and some other chemical compound, the latter of which is
different for each well across the plate. The other wells may be empty, intended for use
as optional experimental controls.
To prepare for an assay, the researcher fills each well of the plate with some biological
entity that he or she wishes to conduct the experiment upon. In the present case the
test system comprising a Lrrfipl nucleic acid or protein is to be filled in. After some
incubation time has passed to allow the biological matter to absorb, bind to, or
otherwise react (or fail to react) with the compounds in the wells, measurements are
taken across all the plate's wells, either manually or by a machine. A specialized
automated analysis machine can run a number of experiments on the wells (such as
shining polarized light on them and measuring reflectivity, which can be an indication of
protein binding). In this case, the machine may output the result of each experiment as
a grid of numeric values, with each number mapping to the value obtained from a single
well. A high-capacity analysis machine can measure dozens of plates in the space of a
few minutes like this, generating thousands of experimental data points very quickly.
In a preferred embodiment of the present invention the pain is neuropathic pain.
Neuralgia or neuropathic pain can be defined as non-nociceptive pain, or in other words,
pain that is not related to activation of pain receptor cells in any part of the body. It is
believed that neuralgia is pain produced by a change in neurological structure or
function. Unlike nociceptive pain, neuralgia exists with no continuous nociceptive input.
Neuralgia falls into two categories: central neuralgia and peripheral neuralgia. This
unusual pain is thought to be linked to four possible mechanisms: ion gate malfunctions;
the nerve becomes mechanically sensitive and creates an ectopic signal; cross signals
between large and small fibers; and malfunction due to damage in the central processor.
Neuralgia is often difficult to diagnose, and most treatments show little or no
effectiveness. Diagnosis typically involves locating the damaged nerve by identifying
missing sensory or motor function. This may involve tests such as an EMG test or a
nerve conduction test. Neuralgia is more difficult to treat than other types of pain
because it does not respond well to normal pain medications. This proves that there is a
need for developing new method of diagnosing and treating this pain and Lrrfipl nucleic
acid and protein provide an interesting target therefore.
In a third aspect the present invention provides the use of a Lrrfipl nucleic acid for
identifying a compound involved in pain and in a forth aspect the present invention
provides the use of Lrrfipl protein for identifying a compound involved in pain.
With respect to the terms "Lrrfipl nucleic acid", "Lrrfipl protein" and "identifying a
compound involved in pain" it is referred to the definitions provided in the context of the
methods of the present invention. It is noted that the methods described above may be
used for the identification.
In a preferred embodiment of the third or forth aspect of the present invention, the
compound and/or the pain is as defined above in the context of the preferred
embodiments of the method of the present invention.
The compound involved in pain identified according to the present invention could be
used as a medicament. For the production of the medicament the identified target or its
pharmaceutically acceptable salt has to be in a pharmaceutical dosage form in general
consisting of a mixture of ingredients such as pharmaceutically acceptable carriers or
auxiliary substances combined to provide desirable characteristics.
The formulation comprises at least one suitable pharmaceutically acceptable carrier or
auxiliary substance. Examples of such substances are demineralised water, isotonic
saline, Ringer's solution, buffers, organic or inorganic acids and bases as well as their
salts, sodium chloride, sodium hydrogencarbonate, sodium citrate or dicalcium
phosphate, glycols, such a propylene glycol, esters such as ethyl oleate and ethyl
laurate, sugars such as glucose, sucrose and lactose, starches such as corn starch and
potato starch, solubilizing agents and emulsifiers such as ethyl alcohol, isopropyl
alcohol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene
glycol, 1,3-butylene glycol, dimethyl formamide, oils such as groundnut oil, cottonseed
oil, corn oil, soybean oil, caster oil, synthetic fatty acid esters such as ethyl oleate,
isopropyl myristate, polymeric adjuvans such as gelatin, dextran, cellulose and its
derivatives, albumins, organic solvents, complexing agents such as citrates and urea,
stabilizers, such as protease or nuclease inhibitors, preferably aprotinin, -aminocaproic
acid or pepstatin A, preservatives such as benzyl alcohol, oxidation inhibitors such as
sodium sulphite, waxes and stabilizers such as EDTA. Colouring agents, releasing
agents, coating agents, sweetening, flavouring and perfuming agents, preservatives and
antioxidants can also be present in the composition. The physiological buffer solution
preferably has a pH of approx. 6.0-8.0, especially a pH of approx. 6.8-7.8, in particular a
pH of approx. 7.4, and/or an osmolarity of approx. 200-400 milliosmol/liter, preferably of
approx. 290-31 0 milliosmol/liter. The pH of the medicament is in general adjusted using
a suitable organic or inorganic buffer, such as, for example, preferably using a
phosphate buffer, tris buffer (tris(hydroxymethyl)aminomethane), HEPES buffer
([4-(2-hydroxyethyl)piperazino]ethanesulphonic acid) or MOPS buffer (3-morpholino-
1-propanesulphonic acid). The choice of the respective buffer in general depends on the
desired buffer molarity. Phosphate buffer is suitable, for example, for injection and
infusion solutions. Methods for formulating a medicaments as well as suitable
pharmaceutically acceptable carrier or auxiliary substance are well known to the one of
skill in the art. Pharmaceutically acceptable carriers and auxiliary substances are a . o.
chosen according to the prevailing dosage form and identified compound.
The pharmaceutical composition can be manufactured for oral, nasal, rectal, parenteral,
vaginal, topic or vaginal administration. Parental administration includes subcutaneous,
intracutaneous, intramuscular, intravenous or intraperitoneal administration.
The medicament can be formulated as various dosage forms including solid dosage
forms for oral administration such as capsules, tablets, pills, powders and granules,
liquid dosage forms for oral administration such as pharmaceutically acceptable
emulsions, microemulsions, solutions, suspensions, syrups and elixirs, injectable
preparations, for example, sterile injectable aqueous or oleaginous suspensions,
compositions for rectal or vaginal administration, preferably suppositories, and dosage
forms for topical or transdermal administration such as ointments, pastes, creams,
lotions, gels, powders, solutions, sprays, inhalants or patches.
The specific therapeutically effective dose level for any particular patient will depend
upon a variety of factors including the activity of the identified compound, the dosage
form, the age, body weight and sex of the patient, the duration of the treatment and like
factors well known in the medical arts.
The total daily dose of the compounds of this invention administered to a human or
other mammal in single or in divided doses can be in amounts, for example, from about
0.01 to about 50 mg/kg body weight or more preferably from about 0.1 to about 25
mg/kg body weight. Single dose compositions may contain such amounts or
submultiples thereof to make up the daily dose. In general, treatment regimens
according to the present invention comprise administration to a patient in need of such
treatment from about 10 mg to about 1000 mg of the compound(s) of the compounds of
the present invention per day in single or multiple doses.
In a fifth aspect the present invention provides a method of diagnosing algesia,
comprising the steps of
a) determining the level expression of the Lrrfipl gene in a subject's sample, and
b) identifying the subject as algesic, if the level expression of the Lrrfipl gene is
increased in the subject's sample relative to a control.
As shown in the Example, the expression level of the Lrrfipl gene is correlated with
algesia. Accordingly, the expression level may be used in or to diagnose Lrrfipl -related
algesia. The expression level of a gene may be detected on the gene level, the mRNA
level or the protein level.
Increased expression level could be due to increased copy number of the Lrrfipl gene.
A series of diseases are known, which are due to an increased number of copies of a
gene. For example, one cause of breast cancer may be HER-2 amplification. Gene
amplification may be determined by immunohistochemistry (IHC) and either silver,
chromogenic or fluorescent in situ hybridisation (SISH/CISH/FISH).
In situ hybridization (ISH) of the probe takes place within the cell or tissue. Since cellular
structure is maintained throughout the procedure, ISH provides information about the
location of mRNA within the tissue sample. The procedure begins by fixing samples in
e.g. neutral-buffered formalin, and embedding the tissue in paraffin. The samples are
then sliced into thin sections and mounted onto microscope slides. (Alternatively, tissue
can be sectioned frozen and post-fixed in paraformaldehyde.) After a series of washes
to dewax and rehydrate the sections, a Proteinase K digestion is performed to increase
probe accessibility, and a labeled probe is then hybridized to the sample sections.
Radiolabeled probes are visualized with liquid film dried onto the slides, while
nonisotopically labeled probes are conveniently detected with colorimetric or fluorescent
reagents.
Alternatively, gene amplification can be detected by virtual karyotyping or Comparative
Genomic Hybridization. Platforms for generating high-resolution karyotypes in silico
from disrupted DNA have emerged, such as array comparative genomic hybridization
(arrayCGH) and SNP arrays. Conceptually, the arrays are composed of hundreds to
millions of probes which are complementary to a region of interest in the genome. The
disrupted DNA from the test sample is fragmented, labeled, and hybridized to the array.
The hybridization signal intensities for each probe are used by specialized software to
generate a log2 ratio of test/normal for each probe on the array. Knowing the address of
each probe on the array and the address of each probe in the genome, the software
lines up the probes in chromosomal order and reconstructs the genome in silico.
In addition numerous PCR-based methodologies have also been described above.
Alternatively, or additionally, Lrrfipl expression level may also be detect on mRNA or
protein level. In this case, the amount of mRNA or Lrrfipl protein is detected. Suitable
methods for detecting mRNA or protein are detailed above.
The invention is not limited to the particular methodology, protocols, and reagents
described herein because they may vary. Further, the terminology used herein is for the
purpose of describing particular embodiments only and is not intended to limit the scope
of the present invention. As used herein and in the appended claims, the singular forms
"a", "an", and "the" include plural reference unless the context clearly dictates otherwise.
Similarly, the words "comprise", "contain" and "encompass" are to be interpreted
inclusively rather than exclusively.
Unless defined otherwise, all technical and scientific terms and any acronyms used
herein have the same meanings as commonly understood by one of ordinary skill in the
art in the field of the invention. Although any methods and materials similar or
equivalent to those described herein can be used in the practice of the present invention,
the preferred methods, and materials are described herein.
The invention is further illustrated by the following figure and example, although it will be
understood that the examples are included merely for purposes of illustration and are
not intended to limit the scope of the invention unless otherwise specifically indicated.
FIGURES:
Figure 1 shows for every individual mouse its neuropathic pain phenotype scores
(mechanical hypersensitivity, X-axis) and the corresponding gene regulation of Lrrfipl
(log ratio(Chung vs. Sham control), Y-axis) in the L5 DRG. Mouse data are symbolcoded
depending on the used strain. A Pearson correlation analysis has been
performed and revealed a significant negative correlation of the two parameters pain
phenotype and log ratio gene regulation. This means for individual mice that the lower
the L5 DRG expression of Lrrfipl in Chung-operated neuropathic mice was, the more
pronounced the mechanical hyperalgesia as exhibited in the behavioral test.
This significant correlation indicates a causal relationship of Lrrfipl gene expression for
the induction of the neuropathic pain phenotype. (R(Pearson)= -0.684; p-value=
0.0001 2; FDR= 0.026)
Figure 2 shows exemplary intensity data for Lrrfipl of L5 DRG (3d p.o.)
EXAMPLE:
Identification of Lrrfipl as protein involved in algesia
In order to identify new targets for pain therapy, a correlational analysis for identifying
genes whose regulation contributes to chronic neuropathic pain was carried out (see
also Persson et al., 2009, Molecular Pain 5:7). In summary, RNA samples of dorsal root
ganglia (DRGs) of inbred mouse strains AKR/J (AKR), C57BL/6J (C57/B6) and CBA J
(CBA) were examined. Inbred mouse strains obtained from The Jackson Laboratory
(Bar Harbor, ME, USA). The spinal nerve at position L5 of Chung-operated (Chung
model of neuropathic pain (Kim and Chung, 1992, Pain 50: 355-363) and of
corresponding sham-operated control animals were subjected to axotomy. Samples
were profiled with Affymetrix microarrays (MOE430 2.0). At least five animals of each
group were tested. The manifestation of the pain phenotype "mechanic hyperalgesia"
was determined at all mice before removal of DRGs (Persson et al., supra, particularly
section "Behavioral testing"). The three mouse strains differ in their phenotypes. In CBA
mice, C57/B6 mice and AKR mice, the phenotype is manifested at a low, middle and
high level, respectively.
In order to carry out gene expression experiments, a method for isolating total RNA of
murine DRGs was developed (Persson et al., supra, particularly section "RNA extraction
for TaqMan and microarray analysis"), wherein the method provided for RNA in a
sufficient amount (> 300 ng) and quality. After having extracted RNA from L5 DRGs of
the three mouse strains, either Chung-operated or sham-operated control animals, the
RNA probes were hybridized on Affymetrix microarrays (MOE430 2.0).
The Affymetrix gene expression data were statistically analyzed and filtered prior to a
correlation analysis. The following filter criteria were used:
- Abs. fold-change in at least 60 % of all Chung-operated animals > 1.5 or
- in at least 20 % of all Chung-operated animals > 2.0 (each with respect to the
mean value of all sham-operated control animals) and
- gene expression intensity in at least 5 animals > 50 (background level).
Phenotype data of the individual mice of the three strains and their gene expression
data (expressed as log ratio (Chung-operated vs. sham-operated)) or expression
intensity of Chung-operated animals were used for correlation analysis.
For each gene which fulfilled the above filter criteria, a Pearson correlation coefficient of
gene expression data and phenotype data (mechanic hypersensitivity) was calculated
(Persson et al., supra, particularly section "Correlational analysis"). In order to
determine the significance of correlation coefficients of the single genes, a "false
discovery rate" (FDR) was introduced (Storey, J.D. (2002) J. R. Statist. Soc. 64, part 3,
479-498). Pearson correlation coefficients of genes having an FDR > 0.05 were
regarded as significant. Using the log ratio data (Chung-operated vs. sham-operated)
and expression intensity 74 sequences and 114 genes, respectively, were identified.
The data for these sequences/genes showed a significant correlation of gene
expression and phenotype data (FDR < 0.05) and were not known to be involved in pain
and hyperalgesia.
For the Lrrfipl gene which was among the genes with the best correlation of expression
and pain phenotype, the correlation analysis of log ratio data and mechanic
hypersensitivity yielded a Pearson correlation coefficient of -0.684 (p value of 0.0001 2)
and an FDR of 0.026.
Claims
1. A method of identifying a compound involved in pain, the method comprising the
steps of:
a) providing a test system comprising Lrrfipl nucleic acid,
b) contacting the test system with a test compound, and
c) determining the effect of the test compound on the test system,
wherein the test compound is identified as a compound involved in pain, when a
significant effect of the test compound on the test system relative to a control is
detected.
A method of identifying a compound involved in pain, the method comprising the
steps of:
a) providing a test system comprising Lrrfipl protein or a functionally active
variant thereof,
a) contacting the test system with a test compound, and
b) determining the effect of the test compound on the test system,
wherein the test compound is identified as a compound involved in pain, when a
significant effect of the test compound on the test system relative to a control is
detected.
The method of any of claims 1 or 2, wherein the compound involved in pain is a
cellular compound naturally participating in the signal transduction pathway of the
Lrrfipl gene and/or the Lrrfipl protein.
4 . The method of any of claims 1 to 3, wherein the compound involved in pain alters
signal transduction upstream or downstream the Lrrfipl protein.
5 . The method of any of claims 1 to 4, wherein the compound involved in pain alters
signal transduction upstream or downstream the Lrrfipl gene, particularly wherein
the compound alters expression of the Lrrfipl gene.
6 . The method of any of claim 1 to 5, wherein the compound involved in pain binds to
a cellular compound naturally participating in the signal transduction pathway of
the Lrrfipl gene and/or the Lrrfipl protein, particularly wherein the compound
involved in pain binds to the Lrrfipl nucleic acid or the Lrrfipl protein, especially
the Lrrfipl protein.
7 . The method of any of claim 1 to 6, wherein the compound involved in pain inhibits
signal transduction upstream or downstream the Lrrfipl gene, particularly wherein
the compound inhibits expression of the Lrrfipl gene.
8 . The method of any of claim 1 to 7, wherein the compound involved in pain inhibits
signal transduction upstream or downstream the Lrrfipl protein, particularly
wherein the compound binds to the Lrrfipl protein.
9 . The method of any of claims 1 to 8, wherein the test system is in a cell.
10 . The method of any of claims 1 to 9, wherein the method is a high-through-put
method.
11. The method of any of claims 1 to 10, wherein the pain is neuropathic pain.
12 . Use of Lrrfipl nucleic acid for identifying a compound involved in pain.
13 . Use of Lrrfipl protein for identifying a compound involved in pain.
14. The use of claim 12 or 13, wherein the use is further defined as defined in any of
claims 3 to 8 and 11.
15 . A method of diagnosing algesia, comprising the steps of
a) determining the level expression of the Lrrfipl gene in a subject's sample,
and
b) identifying the subject as algesic, if the level expression of the Lrrfipl gene is
increased in the subject's sample relative to a control.
| # | Name | Date |
|---|---|---|
| 1 | 6328-CHENP-2012 FORM-5 18-07-2012.pdf | 2012-07-18 |
| 2 | 6328-CHENP-2012 FORM-3 18-07-2012.pdf | 2012-07-18 |
| 3 | 6328-CHENP-2012 FORM-2 FIRST PAGE 18-07-2012.pdf | 2012-07-18 |
| 4 | 6328-CHENP-2012 FORM-1 18-07-2012.pdf | 2012-07-18 |
| 5 | 6328-CHENP-2012 DRAWINGS 18-07-2012.pdf | 2012-07-18 |
| 6 | 6328-CHENP-2012 DESCRIPTION (COMPLETE) 18-07-2012.pdf | 2012-07-18 |
| 7 | 6328-CHENP-2012 CORRESPONDENCE OTHERS 18-07-2012.pdf | 2012-07-18 |
| 8 | 6328-CHENP-2012 CLAIMS SIGNATURE LAST PAGE 18-07-2012.pdf | 2012-07-18 |
| 9 | 6328-CHENP-2012 CLAIMS 18-07-2012.pdf | 2012-07-18 |
| 10 | 6328-CHENP-2012 PCT PUBLICATION 18-07-2012.pdf | 2012-07-18 |
| 11 | 6328-CHENP-2012.pdf | 2012-07-21 |
| 12 | 6328-CHENP-2012 FORM-3 15-01-2013.pdf | 2013-01-15 |
| 13 | 6328-CHENP-2012 CORRESPONDENCE OTHERS 15-01-2013.pdf | 2013-01-15 |
| 14 | Form-18(Online).pdf | 2014-01-03 |
| 15 | 6328-CHENP-2012-FER.pdf | 2018-01-05 |
| 16 | 6328-CHENP-2012-AbandonedLetter.pdf | 2018-08-28 |
| 1 | search6328_29-12-2017.pdf |