Sign In to Follow Application
View All Documents & Correspondence

Pan Elr+Cxc Chemokine Antibodies

Abstract: Antibodies are provided that specifically bind seven human ELR CXC chemokines. The antibodies of the invention are useful for treating various inflammatory/autoimmune diseases such as inflammatory bowel disease (IBD) plaque psoriasis and palmoplantar pustulosis; and cancer such as renal cancer or ovarian cancer.

Get Free WhatsApp Updates!
Notices, Deadlines & Correspondence

Patent Information

Application #
Filing Date
07 August 2015
Publication Number
51/2015
Publication Type
INA
Invention Field
CHEMICAL
Status
Parent Application
Patent Number
Legal Status
Grant Date
2020-09-09
Renewal Date

Applicants

ELI LILLY AND COMPANY
Lilly Corporate Center Indianapolis Indiana 46285

Inventors

1. BEIDLER Catherine Brautigam
c/o Eli Lilly and Company P. O. Box 6288 Indianapolis Indiana 46206 6288
2. KIKLY Kristine Kay
c/o Eli Lilly and Company P. O. Box 6288 Indianapolis Indiana 46206 6288
3. STRIFLER Beth Ann
c/o Eli Lilly and Company P. O. Box 6288 Indianapolis Indiana 46206 6288
4. WITCHER Derrick Ryan
c/o Eli Lilly and Company P. O. Box 6288 Indianapolis Indiana 46206 6288
5. BOYLES Jeffrey Streetman
c/o Eli Lilly and Company P. O. Box 6288 Indianapolis Indiana 46206 6288

Claims

1. An antibody that neutralizes human Gro-alpha, Gro-beta, Gro-gamma, ENA-78, GCP-2, NAP-2, and IL-8.

2. The antibody of claim 1, wherein the antibody binds IL-8 (SEQ ID NO: 27) at the following amino acids: Arg 6, e 10, Arg 35, e 40.

3. The antibody of claim 2, wherein the antibody further binds IL-8 (SEQ ID NO: 27) at Leu 49.

4. The antibody according to any of claims 1-3, wherein the antibody comprises a light chain, wherein the light chain comprises a light chain variable region (LCVR), wherein the LCVR comprises LCDR1 (RASQSISNNLH (SEQ ID NO: 7)), LCDR2 (YTSRSVS (SEQ ID NO: 8)), and LCDR3 (GQNNEWPEV (SEQ ID NO: 9)) and a heavy chain, wherein the heavy chain comprises a heavy chain variable region (HCVR), wherein the HCVR comprises HCDR1 (GYEFTSYWIH (SEQ ID NO: 10)), HCDR2 (NISPNSGSANYNEKFKS (SEQ ID NO: 11)), and HCDR3 (EGPYSYYPSRXaaYYGSDL (SEQ ID NO: 20)) wherein Xaa is E or Q.

5. The antibody according to any of claims 1-4, wherein the amino acid sequence of the LCVR is SEQ ID NO: 4 or 16 and the HCVR is SEQ ID NO: 2 or SEQ ID NO: 14.

6. The antibody according to any of claims 1-5, wherein the antibody comprises a light chain and a heavy chain, wherein the amino acid of the light chain is SEQ ID NO: 3 or 15, and wherein the amino acid of the heavy chain is SEQ ID NO: 1 or

13. 7. An antibody that binds human Gro-alpha, Gro-beta, Gro-gamma, ENA-78, GCP- 2, NAP-2, and IL-8, the antibody comprising a light chain and a heavy chain, wherein the light chain comprises a light chain variable region (LCVR) and the heavy chain comprises a heavy chain variable region (HCVR), wherein the LCVR comprises LCDR1, LCDR2, LCDR3 and the HCVR comprises HCDR1, HCDR2, HCDR3, wherein LCDR1 is RASQSISNNLH (SEQ ID NO: 7), LCDR2 is YTSRSVS (SEQ ID NO: 8), LCDR3 is GQNNEWPEV (SEQ ID NO: 9), HCDR1 is GYEFTSYWIH (SEQ ID NO: 10), HCDR2 is NISPNSGSANYNEKFKS (SEQ ID NO: 11), and HCDR3 is EGPYSYYPSRXaaYYGSDL (SEQ ID NO: 20) wherein Xaa is E or Q.

8. The antibody of Claim 7, wherein the amino acid sequence of the HCVR is SEQ ID NO: 2 or SEQ ID NO: 14.

9. The antibody of Claim 7, wherein the amino acid sequence of the LCVR is SEQ ID NO: 4 or 16.

10. The antibody of Claim 7, wherein the amino acid sequence of the HCVR is SEQ ID NO: 2 and the amino acid sequence of the LCVR is SEQ ID NO: 4.

11. The antibody of claim 7, wherein the amino acid sequence of the heavy chain is SEQ ID NO: 1 and the amino acid sequence of the light chain is SEQ ID NO: 3.

12. The antibody of claim 7, wherein the antibody comprises two heavy chains having the amino acid sequence of SEQ ID NO: 1 and two light chains having the amino acid sequence of SEQ ID NO: 3.

13. A DNA molecule comprising a first polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 1 or 13; and comprising a second polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ ID NO: 3 or 15.

14. A mammalian cell comprising the DNA molecule of Claims 13, wherein the cell is capable of expressing an antibody of any of Claims 1-12.

15. A process for producing an antibody according to any of claims 1-12, the process comprising cultivating the mammalian cell of Claim 14 under conditions such that the antibody is expressed, and recovering the expressed antibody.

16. An antibody produced by the process of Claim 15.

17. A method of treating ulcerative colitis, renal cancer, or ovarian cancer in a patient, comprising administering to the patient a therapeutically effective amount of an antibody according to any of claims 1-12 and 16.

18. An antibody according to any of claims 1-12 and 16 for use in therapy.

19. An antibody according to any of claims 1-12 and 16 for use in the treatment of ulcerative colitis, renal cancer, or ovarian cancer.

Specification

Pan-ELR+ CXC CHEMOKINE ANTIBODIES
The present invention relates to antibodies against ELR+ CXC chemokines, and
their use in treating diseases where pathogenesis is mediated by ELR+ CXC chemokines.
ELR+ CXC chemokines (so-called because members of the chemokine family all
possess an E-L-R amino acid motif immediately adjacent to their CXC motif) play an
important role in a variety of pathogenic mechanisms, including the migration of
neutrophils to sites of inflammation and angiogenesis. Neutrophils contribute to the
pathogenesis of several acute and chronic inflammatory/autoimmune diseases, such as
inflammatory bowel disease (IBD), plaque psoriasis, and palmoplanar pustulosis. ELR+
CXC chemokines also play a critical role in tumorigenesis and tumor metastasis. These
chemokines are highly expressed in tumors. Within the tumor environment, ELR+ CXC
chemokines are involved in various pathways, for example angiogenesis, mobilization
and invasion of endothelial cells and leukocytes at tumor sites, and proliferation and
survival of tumor cells.
Chemokines are grouped into four subfamilies: CXC, CC, (X)C, and CX3C. In
the CXC chemokines, one amino acid separates the first two cysteines ("the CXC motif).
ELR+ CXC chemokines are ligands for CXCR1 and/or CXCR2 chemokine receptors,
which are G-protein coupled seven transmembrane domain-type receptors that
specifically bind ELR+ CXC chemokines. The seven human ELR+ CXC chemokines are
human Gro-alpha (also known as CXCLl), human Gro-beta (also known as CXCL2),
human Gro-gamma (also known as CXCL3), human ENA-78 (also known as CXCL5),
human GCP-2 (also known as CXCL6), human NAP-2 (also known as CXCL7), and
human IL-8 (also known as CXCL8). All ELR+ CXC chemokines bind the CXCR2
receptor; moreover, some ELR+ CXC chemokines bind both CXCR1 and CXCR2
receptors (i.e., CXCL6 and CXCL8), all of which contributes to redundancy in the
activation pathways.
Antibodies that bind to individual ELR+ CXC chemokines have been previously
described. Two monoclonal antibodies against CXCL8 (IL-8) have been evaluated in
early clinical trials with efficacy in inflammatory diseases. (J Leuk Biol 66:401-410; J
Immunol 181:669-679.) In addition, WO 2008/130969 discloses an antibody that binds
to human IL-8 (CXCL8), human Gro-alpha (CXCLl), human Gro-beta (CXCL2), human
Gro-gamma (CXCL3), and human ENA-78 (CXCL5). However, the disclosure does not
demonstrate that the antibody binds tightly to GCP-2 (CXCL6), and is silent regarding
binding to NAP-2 (CXCL7).
However, an antibody that is able to bind and neutralize all seven human ELR+
CXC chemokines has not yet been disclosed. Targeting one or a few human ELR+ CXC
chemokines leaves open the opportunity for other ELR+ CXC chemokines to elicit
multiple biological functions. Neutralizing all seven ELR+ CXC chemokines could
impact the ability of CXCR1+ or CXCR2+ cells to migrate to sites of inflammation and
could inhibit angiogenesis. Given the significant redundancy in the CXCRl and CXCR2
receptor activation pathways, there is still a need for an antibody that binds all seven
human ELR+CXC chemokines with specificity and with high affinity. There is a need for
an antibody that neutralizes all seven human ELR+ CXC chemokines. There is also a
need for an antibody that is physically stable. It is therefore desirable to provide a septaspecific
antibody that is able to bind and neutralize all seven human ELR+ CXC
chemokines, and is physically stable.
The present invention provides an antibody that neutralizes human Gro-alpha,
Gro-beta, Gro-gamma, ENA-78, GCP-2, NAP-2, and IL-8. The present invention also
provides an antibody that neutralizes human Gro-alpha, Gro-beta, Gro-gamma, ENA-78,
GCP-2, NAP-2, and IL-8, wherein the antibody binds IL-8 (SEQ ID NO: 27) at the
following amino acids: Arg 6, e 10, Ala 35, e 40. The present invention further
provides an antibody that neutralizes human Gro-alpha, Gro-beta, Gro-gamma, ENA-78,
GCP-2, NAP-2, and IL-8, wherein the antibody binds IL-8 (SEQ ID NO: 27) at the
following amino acids: Arg 6, e 10, Ala 35, e 40, and Leu 49.
The present invention provides an antibody comprising a light chain and a heavy
chain, wherein the light chain comprises a light chain variable region (LCVR) and the
heavy chain comprises a heavy chain variable region (HCVR), wherein the LCVR
comprises LCDR1, LCDR2, LCDR3 and the HCVR comprises HCDRl, HCDR2,
HCDR3, wherein LCDR1 is RASQSISNNLH (SEQ ID NO: 7), LCDR2 is YTSRSVS
(SEQ ID NO: 8), LCDR3 is GQNNEWPEV (SEQ ID NO: 9), HCDRl is GYEFTSYWIH
(SEQ ID NO: 10), HCDR2 is NISPNSGSANYNEKFKS (SEQ ID NO: 11), and HCDR3
is EGPYSYYPSRXaaYYGSDL (SEQ ID NO: 20) wherein Xaa is E or Q.
The present invention provides in another aspect an antibody wherein the amino
acid sequence of the HCVR is SEQ ID NO: 2 or SEQ ID NO: 14. The present invention
further provides an antibody wherein the amino acid sequence of the LCVR is SEQ ID
NO: 4 or SEQ ID NO: 16.
The present invention provides an antibody wherein the amino acid sequence of
the heavy chain is SEQ ID NO: 1 or 13. The present invention also provides an antibody
wherein the amino acid sequence of the light chain is SEQ ID NO: 3 or 15.
The present invention also provides a DNA molecule comprising a first
polynucleotide sequence encoding a polypeptide having the amino acid sequence of SEQ
ID NO: 1 or 13; and comprising a second polynucleotide sequence encoding a
polypeptide having the amino acid sequence of SEQ ID NO: 3 or 15.
The present invention provides a mammalian cell comprising the DNA molecules
described above, wherein the cell is capable of expressing an antibody comprising a
heavy chain having an amino acid sequence of SEQ ID NO: 1 or 13 and a light chain
having an amino acid sequence of SEQ ID NO: 3 or 15. Mammalian host cells known to
be capable of expressing functional immunoglobulins include Chinese Hamster Ovary
(CHO) cells, COS cells, and NSO cells. Preferred host cells for use in the invention are
NSO cells.
The present invention further provides a process for producing an antibody
comprising a light chain whose amino acid sequence is SEQ ID NO: 3 or 15 and a heavy
chain whose amino acid sequence is SEQ ID NO: 1 or 13, comprising cultivating a
mammalian cell described above under conditions such that the antibody is expressed,
and recovering the expressed antibody.
The present invention provides a method of treating ulcerative colitis, renal
cancer, or ovarian cancer, comprising administering to a patient in need thereof a
therapeutically effective amount of an antibody of the present invention.
The present invention further provides an antibody of the present invention for use
in therapy. Furthermore, the present invention provides an antibody of the present
invention for use in the treatment of ulcerative colitis, renal cancer, or ovarian cancer.
Additionally, the present invention provides the use of an antibody of the present
invention in the manufacture of a medicament for the treatment of ulcerative colitis, renal
cancer, or ovarian cancer.
The present invention provides a pharmaceutical composition comprising an
antibody of the present invention and one or more pharmaceutically acceptable carriers,
diluents, or excipients.
As used herein, the term "human ELR+ CXC chemokines" is intended to refer to
the seven known CXC chemokines that have an E-L-R motif and that bind to CXCR1
and/or CXCR2 receptor. The human ELR+ CXC chemokines are human Gro-alpha (also
known as CXCL1) (SEQ ID NO: 21), human Gro-beta (also known as CXCL2) (SEQ ID
NO: 22), human Gro-gamma (also known as CXCL3) (SEQ ID NO: 23), human ENA-78
(also known as CXCL5) (SEQ ID NO: 24), human GCP-2 (also known as CXCL6) (SEQ
ID NO: 25), human NAP-2 (also known as CXCL7) (SEQ ID NO: 26), and human IL-8
(also known as CXCL8) (SEQ ID NO: 27). Collectively, all seven human ELR+ CXC
chemokines are called "human pan-ELR+ CXC chemokines" herein.
The term "antibody," as used herein, is intended to refer to monoclonal
immunoglobulin molecules comprising four polypeptide chains, two heavy (H) chains
and two light (L) chains inter-connected by disulfide bonds. Each heavy chain comprises
a heavy chain variable region (HCVR) and a heavy chain constant region. The heavy
chain constant region comprises three domains, CHI, CH2, and CH3. Each light chain is
comprised of a light chain variable region (LCVR) and a light chain constant region, CL.
The HCVR and LCVR regions can be further subdivided into regions of hypervariability,
termed complementarity determining regions (CDRs), interspersed with regions that are
more conserved, termed framework regions (FR). Each HCVR and LCVR is composed
of three CDRs and four FRs, arranged from amino-terminus to carboxy-terminus in the
following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The CDR regions in
HCVR are termed HCDR1, HCDR2, and HCDR3. The CDR regions in LCVR are
termed LCDR1, LCDR2, and LCDR3. The CDRs contain most of the residues which
form specific interactions with the antigen. There are currently three systems of CDR
assignments for antibodies that are used for sequence delineation. The Kabat CDR
definition (Kabat et al., "Sequences of Proteins of Immunological Interest," National
Institutes of Health, Bethesda, Md. (1991)) is based upon antibody sequence variability.
The Chothia CDR definition (Chothia et al., "Canonical structures for the hypervariable
regions of immunoglobulins", Journal of Molecular Biology, 196, 901-917 (1987); Al-
Lazikani et al., "Standard conformations for the canonical structures of
immunoglobulins", Journal of Molecular Biology, 273, 927-948 (1997)) is based on
three-dimensional structures of antibodies and topologies of the CDR loops. The Chothia
CDR definitions are identical to the Kabat CDR definitions with the exception of HCDRl
and HCDR2. For the purposes of the present invention, a hybrid of the Kabat and
Chothia definitions are used to define CDRs. The assignment of amino acids in the
HCVR and LCVR regions is in accordance with the Kabat numbering convention. It is
further understood that the term "antibody" encompasses any cellular post-translational
modifications to the antibody including, but not limited to, acylation and glycosylation.
As used herein, the term "neutralizing antibody" is intended to refer to an
antibody whose binding to an ELR+ CXC chemokine results in inhibition of a biological
activity induced by that chemokine. This inhibition of a ELR+ chemokine-induced
biological activity can be assessed by one or more of several standard in vitro assays
known in the art (see Examples). It is further understood that the terms "inhibit" or
"neutralize" as used herein with respect to an activity of an antibody of the invention
means the ability to antagonize, reduce, or disrupt the progression, intensity, or severity
of a biological activity induced by one or more ELR+ CXC chemokines.
As used herein, the term "septa-specific antibody" is intended to encompass an
antibody that binds all seven human ELR+ CXC chemokines with high affinity (e.g. , with
binding affinity (¾) in the range of from about 5 x 10 M to about 1 x 10 9 M).
As used herein, a "patient" refers to a mammal, preferably a human with a
disease, disorder, or condition that would benefit from a decreased level of human ELR+
CXC chemokines or decreased bioactivity induced by human ELR+ CXC chemokines.
As used herein, "treatment" or "treating" is intended to refer to all processes
wherein there may be a slowing, controlling, or stopping of the progression of the
disorders disclosed herein, but does not necessarily indicate a total elimination of all
disorder symptoms. Treatment includes administration of an antibody of the present
invention for treatment of a disease or condition in a patient, particularly in a human.
The antibodies of the present invention bind human pan-ELR+ CXC chemokines
with high affinity. For example, the present antibodies bind all seven human ELR+ CXC
chemokines with a binding affinity (KD) in the range of from about 5 x 10 M to about 1
x 10 9 M, for example from about 1.0 x 10 1 M to about 8.6 x 10 1 M, as measured by
surface plasmon resonance, when expressed as a full-length IgG4 antibody. The
antibodies of the present invention are further characterized in that while they bind human
pan-ELR+ CXC chemokines with specificity, they do not specifically bind to other CXC
chemokines, for example stromal cell-derived factor-1 alpha (SDF- I , also known as
CXCL12).
In an embodiment, the antibodies of the invention can have a heavy chain variable
region and a light chain variable region, wherein the heavy chain variable region
comprises CDR regions with the following amino acid sequences: HCDR1 (SEQ ID NO:
10), HCDR2 (SEQ ID NO: 11), and HCDR3 (SEQ ID NO: 12); and wherein the light
chain variable region comprises CDR regions with the following amino acid sequences:
LCDR1 (SEQ ID NO: 7), LCDR2 (SEQ ID NO: 8) and LCDR3 (SEQ ID NO: 9).
In another embodiment, the antibodies of the invention can have a heavy chain
variable region and a light chain variable region, wherein the heavy chain variable region
comprises CDR regions with the following amino acid sequences: HCDR1 (SEQ ID NO:
10), HCDR2 (SEQ ID NO: 11), and HCDR3 (SEQ ID NO: 19); and wherein the light
chain variable region comprises CDR regions with the following amino acid sequences:
LCDR1 (SEQ ID NO: 7), LCDR2 (SEQ ID NO: 8) and LCDR3 (SEQ ID NO: 9).
In a further embodiment, the antibodies of the invention can comprise a heavy
chain variable region having the amino acid sequence of SEQ ID NO: 2 or 14, and a light
chain variable region having the amino acid sequence of SEQ ID NO: 4 or 16.
In yet a further embodiment, the antibodies of the invention can comprise a heavy
chain having the amino acid sequence of SEQ ID NO: 1 or 13, and a light chain having
the amino acid sequence of SEQ ID NO: 3 or 15.
Preferably, the antibodies comprise two identical light chains and two identical
heavy chains. Preferably, the light chain with amino acid sequence as shown in SEQ ID
NO: 3 is encoded by a nucleic acid comprising the polynucleotide sequence shown in
SEQ ID NO: 6. Preferably, the heavy chain with amino acid sequence as shown in SEQ
ID NO: 1 is encoded by a nucleic acid comprising the polynucleotide sequence shown in
SEQ ID NO: 5. Preferably, the light chain amino acid sequence as shown in SEQ ID NO:
15 is encoded by a nucleic acid comprising the polynucleotide sequence shown in SEQ
ID NO: 18. Preferably, the heavy chain amino acid sequence as shown in SEQ ID NO:
13 is encoded by a nucleic acid comprising the polynucleotide sequence shown in SEQ
ID NO: 17.
The most preferred embodiment of the invention is an antibody comprising two
identical heavy chains having the amino acid sequence of SEQ ID NO: 1, and two
identical light chains having the amino acid sequence of SEQ ID NO: 3.
Antibodies of the present invention can be incorporated into pharmaceutical
compositions suitable for administration to a patient. Typically the pharmaceutical
composition comprises an antibody of the invention and a pharmaceutically acceptable
carrier. As used herein, "pharmaceutically acceptable carrier" includes any and all
solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and
absorption delaying agents, and the like that are physiologically compatible.
Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary
substances that enhance the shelf life or effectiveness of the antibody.
The compositions of this invention may be in a variety of forms. The preferred
form depends on the intended mode of administration and therapeutic application.
Typical preferred compositions are in the form of injectable or infusible solutions, such as
compositions similar to those used for passive immunization of humans. The preferred
mode of administration is parenteral (e.g. , intravenous, subcutaneous, intraperitoneal, or
intramuscular). In an embodiment, the antibody is administered by intraperitoneal or
subcutaneous injection. However, as will be appreciated by the skilled artisan, the route
and/or mode of administration will vary depending upon the desired results.
Supplementary active compounds can also be incorporated into the
pharmaceutical compositions. In certain embodiments, an antibody of the invention is coformulated
with and/or co-administered with one or more additional therapeutic agents
that are useful for treating disorders in which ELR+ CXC chemokine activity is
detrimental. For example, an antibody of the invention may be co-formulated and/or co
administered with one or more chemotherapy agents (e.g. , sunitinib or cisplatin).
The pharmaceutical compositions of the invention may include a "therapeutically
effective amount" of an antibody of the invention. A "therapeutically effective amount"
refers to an amount effective, at dosages and for periods of time necessary, to achieve the
desired therapeutic result. A therapeutically effective amount of the antibody may vary
according to factors such as the disease state, age, sex, and weight of the individual, and
the ability of the antibody to elicit a desired response in the individual. A therapeutically
effective amount is also one in which any toxic or detrimental effects of the antibody are
outweighed by the therapeutically beneficial effects.
Dosage regimens may be adjusted to provide the optimum desired response (e.g.,
a therapeutic response). For example, a single bolus may be administered, several
divided doses may be administered over time, or the dose may be proportionally reduced
or increased as indicated by the exigencies of the therapeutic situation.
Dosage values may vary with the type and severity of the condition to be
alleviated. It is further understood that for any particular subject, specific dosage
regimens should be adjusted over time according to the individual need and the
professional judgment of the person administering or supervising the administration of
the compositions.
Specific binding of and neutralization by an antibody of the present invention to
human ELR+ CXC chemokines allows said antibody to be used as a therapeutic for
diseases and disorders which benefit from inhibition of human ELR+ CXC chemokine
bioactivity. Given their ability to bind and neutralize all seven human ELR+ CXC
chemokines, antibodies of the present invention offer advantages over monotherapies
targeting single human ELR+ CXC chemokines and combination therapies targeting
multiple human ELR+ CXC chemokines.
In an embodiment, the invention provides a method for treating ulcerative colitis
or cancer, such as renal cancer or ovarian cancer. In another embodiment, the invention
provides an antibody for use in treating ulcerative colitis or cancer, such as renal cancer
or ovarian cancer.
This invention is further illustrated by the following non-limiting examples.
EXAMPLES
Expression and Production of Antibodies
Antibodies of the present invention can be expressed and purified as follows. An
expression vector containing the DNA sequence of SEQ ID NO: 5 (encoding a heavy
chain polypeptide of SEQ ID NO: 1) and SEQ ID NO: 6 (encoding a light chain
polypeptide of SEQ ID NO: 3) is used to transfect NSO cells. An antibody resulting from
this expression vector is "Antibody 1."
Additionally, an expression vector containing the DNA sequence of SEQ ID NO:
17 (encoding a heavy chain polypeptide of SEQ ID NO: 13) and SEQ ID NO: 18
(encoding a light chain polypeptide of SEQ ID NO: 15) is used to transfect NSO cells. An
antibody resulting from this expression vector is "Antibody 2."
For either Antibody 1 or Antibody 2, transfected pools are plated at low density to
allow for close-to-clonal outgrowth of stable expressing cells. The masterwells are
screened for antibody expression and then scaled up in serum-free, suspension cultures to
be used for production. Clarified media, into which the antibody has been secreted, is
applied to a Protein A or G column that has been equilibrated with a compatible buffer,
such as phosphate buffered saline (pH 7.4). The column is washed to remove nonspecific
binding components. The bound antibody is eluted by pH gradient (such as 0.1 M
sodium phosphate buffer pH 6.8 to 0.1 M sodium citrate buffer pH 2.5). Antibody
fractions are detected by SDS-PAGE and then are pooled. Further purification is
optional, depending on the intended use. The antibody may be concentrated and/or sterile
filtered using common techniques. Soluble aggregate and multimers may be effectively
removed by common techniques, including size exclusion, hydrophobic interaction, ion
exchange, or hydroxyapatite chromatography. The purity of the antibody after these
chromatography steps may be greater than 99%. The product may be immediately frozen
at -70°C or may be lyophilized.
Binding Affinity to Human ELR+ CXC Chemokines
Biacore 2000 instrument and Biacore 2000 Evaluation Software Version 4.1 are
used for surface plasmon resonance analysis. A CM5 chip is prepared using
manufacturer's EDC/NHS amine coupling method. Briefly, the surfaces of all four flow
cells are activated by injecting a 1:1 mixture of EDC/NHS for 7 minutes at 10 mE/min.
Protein A is diluted to 100 mg/mL in 10 mM acetate, pH 4.5 buffer, and immobilized to
achieve approximately 10,000 RU onto all 4 flow cells by 7-minute injection at a flow
rate of 10 mE/minute. Unreacted sites are blocked with a 7-minute injection of
ethanolamine at 10 mE/minute. Two injections of glycine (pH 1.5) for 30 seconds at 10
mE/minute are used to remove any non-covalently associated protein. Running buffer is
HBS-EP+.
Antibody 1 or Antibody 2 is diluted to 2 mg/mL in running buffer, and
approximately 400-600 RU is captured in flow cell (Fc). Ligands are diluted from 100
mg/mL to 50 nM in running buffer and then two-fold serially diluted in running buffer to
3.125 nM. Duplicate injections of each ligand concentration are injected at 100 mE/min
for 150 seconds followed by a dissociation phase. The dissociation phase is 1800 seconds
for all ligands. Regeneration is performed by injecting 10 mM glycine (pH 1.5) for 60
seconds at 50mI7ih h over all flow cells. Reference-subtracted data is collected as Fc2-
Fcl, Fc3-Fcl, and Fc4-Fcl. The measurements are obtained at 25°C. The on-rate (kon)
and off-rate (k0ff) for each ligand are evaluated using a "1:1 (mass transfer) Binding"
binding model. The affinity (KD) is calculated from the binding kinetics according to the
relationship: K = k0f /kon.
The human ELR+CXC chemokines produce a concentration-dependent binding
response with Antibody 1 and Antibody 2. Tables 1 and 2 summarize the kon, k0 , and K
values for Antibody 1 and Antibody 2. These results demonstrate that Antibody 1 and
Antibody 2 bind all seven human ELR+ CXC chemokines with high affinity.
Table 1 In Vitro Binding Affinities to Human ELR+ CXC Chemokines for Antibody
1
Table 2 In Vitro Binding Affinities to Human ELR+ CXC Chemokines for
Antibody 2
Physical Stability Evaluation
Protein aggregation and self-association is an undesirable property in antibodies as
it could potentially exacerbate unwanted effects, such as triggering an immune response.
Thus, maintaining the antibody in a monomeric state is highly desirable. Percent high
molecular weight ( HMW) aggregate is an indicator of protein aggregation and selfassociation.
A higher HMW aggregate indicates increased protein aggregation/selfassociation
and increased physical instability. Physical stability of Antibody 1 and
Antibody 2 are determined as follows.
Antibody is dialyzed overnight at 4°C into 10 mM Citrate, pH 6 +/- 150 mM
NaCl. The next morning, the samples are concentrated to 50 mg/mL, filtered through 0.2
micron filters, and then Tween-80 is added to a final concentration of 0.02%. Each
sample is incubated at 25°C for the specified times. Soluble aggregate formation is
followed by analytical SEC using a TSK3000SWXL, 5 micron column with dimensions
30 cm x 0.78 cm. The mobile phase is 50 mM Sodium Phosphate, pH 7, 175 mM NaCl,
at a flow rate of 0.5 mL/min. Samples are applied as 1 E injections and monitored at
280 nm to determine the increase % HMW aggregate (Table 3).
The 50 mg/mL formulations are incubated for 1 and 4 weeks at 25°C to assess
longer-term stability under stress conditions. The delta %HMW aggregate is determined
by subtracting the HMW aggregate at time zero (designated as 'Initial' in Table 3) from
the HMW at the 1 week or 4 week time point. After 1 and 4 weeks, both Antibody 1
and Antibody 2 demonstrated delta HMW below 1%, thus demonstrating good physical
stability.
Table 3 % High Molecular Weight Aggregate
Antibody Epitope Mappingfor Antibody 1
Multiple approaches are undertaken to characterize the epitope for Antibody 1,
including Western blot analysis, co-crystallization of the antibody with several ELR+
CXC chemokines, and mutational analysis for binding and neutralization.
Western Blot Analysis
To determine if Antibody 1 is able to bind a linear or conformational epitope,
Western blot analysis is performed using reducing and non-reducing conditions.
Electrophoresis of the proteins is performed using pre-cast NuPAGE® 4-12% Bis-Tris
gels. NuPAGE® MES SDS running buffer is added to both the inner (200 mL) and outer
(at least 600 mL) chambers of the mini-cells. Serial dilutions of human CXCL8 (400 ng,
100 ng, or 25 ng per lane) are made in NuPAGE® LDS 4X Sample Buffer with or
without NuPAGE® 10X Sample Reducing Agent. Samples are heated at 95°C for 2
minutes. Load volumes are 10 m per lane for the samples, and 5 m per lane for the
SeeBlue Plus2 Prestained Standard marker. The gels are run at 200V for 35 minutes at
room temperature.
Proteins are transferred to PVDF using the iBlot® Dry Blotting System with
iBlot® Transfer Stack, Nitrocellulose, Mini. The membrane is blocked in blocking
solution (3% nonfat milk in phosphate buffered saline) for 1 hour at room temperature.
Antibody 1 is added to the blocking solution to a final concentration of 1 g/mL and then
is incubated for 2 hours at room temperature. Following primary incubation, the
antibody/block solution is removed, and the membrane is washed 3 times for 15 minutes
in wash buffer (phosphate buffered saline + 0.05% Tween 20). The membrane is then
incubated with HRP conjugated donkey anti-human Fc specific IgG secondary antibody
(0. 1 g/mL in blocking solution) for 1 hour at room temperature. After removal of the
secondary antibody, the membrane is washed 4 times for 10 minutes with wash buffer.
The membrane is then incubated with working solution of the Stable Peroxide Solution
and the Luminol/Enhancer Solution (Super Signal West Pico Chemiluminescent
Substrate) for 5 minutes. The membrane is placed in a plastic membrane protector in an
X-ray film cassette with CL-X Posure™ Film for 30 seconds. Film is developed using a
Konica SRX-101 system.
Under non-reducing conditions, at a CXCL8 concentration of 400 ng, two bands
appeared at about 17 kDa and about 10 kDa. At a CXCL8 concentration of 100 ng, one
band appeared at about 10 kDa. At a CXCL8 concentration of 25 ng, no bands appeared.
Under reducing conditions, no bands appeared at any of the tested concentrations.
The results demonstrated that Antibody 1 is able to bind non-reduced, denatured
human CXCL8, but is unable to bind reduced, denatured human CXCL8. Therefore, the
two disulfide bonds in CXCL8 are needed to maintain the antibody epitope. These results
demonstrate a conformational epitope for Antibody 1.
Crystal Structure Analysis
Crystal structures of the Fab/antigen complexes for human CXCL8, and
cynomolgus monkey CXCL2, CXCL3, and CXCL7 are obtained to determine the
complete binding surface of Antibody 1. Wild type truncated human CXCL8 1-66,
human CXCL8 point mutants, and cynomolgus monkey CXCL7 are all expressed in E.
coli with N-terminal His-SUMO tags. These proteins are refolded; the tags are cleaved;
and the proteins are purified by standard purification techniques. Cynomolgus monkey
CXCL2 and CXCL3 are expressed in HEK293 EBNA cells and are purified by standard
purification techniques. Formation of disulfide bonds is confirmed by tryptic digest and
mass fingerprint analysis, and activity is confirmed by neutrophil chemotaxis assay. A
Fab of Antibody 1 is expressed in HEK293 EBNA cells and is purified by standard
purification techniques. Fab/antigen complexes are formed by adding slight molar excess
of antigen to the Fab, followed by size exclusion chromatography purification to remove
excess free antigen. Complexes are crystallized, and the crystal structures are solved by
molecular replacement using Buster 2.9.5 (Global Phasing Ltd.).
These crystal structures confirmed that the epitope for Antibody 1 included the Nterminus
of the ELR+ CXC chemokines, but they also showed contacts between the Fab
and the bΐ - b2 loop and the b2 and b3 strands of the ELR+ CXC chemokines. The crystal
structures also demonstrate that the antibody specifically recognizes the fold of the ELR+
CXC chemokines, since the crystal structures were superimposable. Numerous hydrogen
bonding and Van der Waals interactions were also observed. Most notably, the conserved
R6 side chain of the ELR motif sat in a deep binding pocket formed by the Fab heavy
chain at residues W33, Y102, and Yl 10, and the Fab light chain at residue W94. The
wild type truncated human CXCL8 chemokine also hydrogen bonds with both the Fab
heavy chain at residue E99 and the Fab light chain at the N91 backbone carbonyl. Other
hydrogen bonds observed were between the L5 backbone carbonyl of the wild type
truncated human CXCL8 chemokine and the Fab light chain W94 backbone amide; the
110 backbone carbonyl of the wild type truncated human CXCL8 chemokine and the Fab
heavy chain S52 side chain; the Kl 1 side chain of the wild type truncated human CXCL8
chemokine and the Fab heavy chain T30 and S31 side chains; the H33 side chain of the
wild type truncated human CXCL8 chemokine and the Fab light chain W94 backbone
carbonyl; the A35 backbone amide and the Fab heavy chain N59 side chain; and the C50
backbone amide of the wild type truncated human CXCL8 chemokine and the Fab heavy
chain Y104 backbone carbonyl. Further, the N-terminal residues 5 through 13 of the wild
type truncated human CXCL8 chemokine made numerous contacts with the Fab as the Nterminus
sat in a groove between the Fab heavy chain CDR2 and CDR3. Additionally,
the Fab heavy chain CDR3 loop extended away from this groove and interacted with the
non-N-terminal residue 140 on the b2 strand, and residues Glu48, Leu49, and Cys50 on
the b3 strand of the wild type truncated human CXCL8 chemokine. Finally, residues 33-
36 of the b1-b2 loop in the wild type truncated human CXCL8 chemokine packs against
the Fab heavy chain CDR2.
Mutational Analysis
Several key contacts between the Antibody 1 Fab and wild type human CXCL8
are observed in the crystal structure and are further tested through binding kinetic studies
and U937-huCXCR2 fluorescent imaging plate reader (FLIPR) neutralization of human
CXCL8 point mutants. To study these key contacts, several point mutants (R6A, I10A,
A35P, I40A, and L49A) are made based on the human CXCL8 sequence (SEQ ID NO:
27). Wild type, R6A, I10A, A35P, I40A, and L49A human CXCL8 point mutants are
expressed, refolded, and purified according to standard techniques. Formation of
disulfide bonds is confirmed by tryptic digest and mass fingerprint analysis, and activity
is confirmed by neutrophil chemotaxis assay.
Binding kinetics are tested on a Biacore 2000 instrument with Biacore 2000
Evaluation Software Version 4.1 as described above. Wild type and mutant human
CXCL8 are tested for biologic activity and for neutralization by Antibody 1 using the
U937-huCXCR2 assay. U937-huCXCR2 is a monocytic cell line transduced with
retrovirus for expression of human CXCR2.
CXCL8 mutants are serially diluted in Assay Buffer containing 0.2% BSA in
wells of v-bottom 96-well polypropylene plates. Ligand concentrations are 3 times the
final assay concentration (final assay concentrations range from 300 to 0.0051 nM). A
cell plate and a ligand plate are loaded into a Fluorescent Imaging Plate Reader (FLIPR-3,
Molecular Devices) programmed to transfer 50 m of ligand to wells of the cell plate.
Fluorescence is recorded at 1 second intervals for 90 seconds. The change in
fluorescence [delta relative fluorescence units (DRFU), Max RFU-Min RFU] is
calculated from images 10 to 90. DRFU versus log (ligand concentration) is plotted and
EC5 0 values are determined by nonlinear regression using Graph Pad Prism. Assays are
performed in triplicate over three assay plates.
Antibody 1 is serially diluted in Assay Buffer containing 0.2% BSA. Antibody
concentrations are 3 times the final assay concentration (final concentrations range from
10 to 0.0195 g/ml). Stock solutions of wild type human CXCL8 and CXCL8 mutants
are prepared in Assay Buffer + 0.2% BSA at 240 nM (30x the final assay concentration of
8nM). 20 m of ligand is mixed with 180 m of Antibody 1 in wells of v-bottom 96-well
polypropylene plates. Ligand and antibody are incubated at room temperature for 30
minutes. A cell plate and a ligand- antibody plate are loaded into a Fluorescent Imaging
Plate Reader (FLIPR-3, Molecular Devices) programmed to transfer 50 m of ligandantibody
to wells of the cell plate. Fluorescence is recorded at 1 second intervals for 90
seconds. The change in fluorescence (DRFU) is calculated from images 10 to 90. DRFU
versus log (antibody concentration) is plotted and IC50 values are determined by nonlinear
regression using Graph Pad Prism. Assays are performed in triplicate over three assay
plates.
The binding kinetics, biologic activity, and neutralization results are summarized
in Table 4. The measurements are obtained at 25°C. The on-rate ( k o n ) and off -rate ( k 0ff)
for each ligand are evaluated using a "1:1 (mass transfer) Binding" binding model. The
affinity (¾) is calculated from the binding kinetics according to the relationship: ¾ =
Several of the mutations knocked out activity to the receptor (EC 50) and, therefore,
could not be tested for neutralization. It is noted that the A35P mutation completely
abolished neutralizing activity despite having full activity to the receptor. These results
highlight key contacts (R6, 110, A35, 140, and L49) within the binding interface of the
CXCL8 antigen that are important for antibody binding.
Binding kinetics, U937 FLIPR activity (ECsn), and U937 FLIPR
neutralization (IC ) of human CXCR8 wild type and mutants .
Overall, the epitope mapping analysis for Antibody 1 demonstrated that the
binding interface of the antigen includes the N-terminus of the ELR+ CXC chemokines
(amino acids 5- 13), the b 1-b2 loop (amino acids 33-36), and the b2 and b3 strands (amino
acids 40, 48-50). Key contacts within this interface that are important for antibody
binding include the amino acids R6, 110, A35, 140, and L49 in CXCL8 (SEQ ID NO: 27).
Neutralization Assays
In Vitro Neutralization of Human ELR+ CXC Chemokines Using Human CXCR2-
Transfected HMEC Cells
Since all of the ELR+ CXC chemokines can bind CXCR2 receptor, cells
expressing CXCR2 were selected for in vitro studies. HMEC-huCXCR2 is an
immortalized human endothelial cell line transduced with retrovirus for expression of
human CXCR2 receptor. HMEC cells expressing human CXCR2 are able to induce
intracellular Ca + influx in response to human, cynomolgus monkey, rat, and mouse ELR+
CXC chemokines. Intracellular Ca + influx can be detected by a Fluorescent Imagine
Plate Reader (FLIPR). Chemokine neutralization should therefore also neutralize
intracellular Ca + influx induced by these chemokines.
HMEC-huCXCR2 is maintained in MCDB 31 medium supplemented with 10%
fetal bovine serum, 2x GlutaMax, l x non-essential amino acids, 1 g/mL hydrocortisone,
10 ng/mL human Epidermal Growth Factor, and 0.4 g/mL puromycin at 37°C in 5%
C0 2. Cultures are maintained at sub-confluent densities (50-80% confluent). Cells are
harvested with TrypLE Express, cell density is adjusted to 3xl0 5 cells/mL in complete
culture medium, and 100 E of the cell suspension are seeded into wells of black clearbottom
assay plates. Cell plates are incubated at room temperature for 30 minutes to
allow cells to settle to the bottom of the wells before plates are incubated overnight at
37°C in 5% C0 2. For each assay plate, the contents of one vial of Fluo-4NW reagent is
suspended in 10 mL Assay Buffer and 100 E probenecid to make l x Fluo-4NW reagent.
After incubation, culture medium is aspirated and 100 E of the l x Fluo-4NW solution is
added to each well of the assay plate. Plates are incubated for 30 minutes at 37°C,
followed by an additional 30 minutes at room temperature and protected from light.
Antibody 1 is serially diluted in Assay Buffer containing 0.2% BSA. Antibody
concentrations are 3x the final assay concentration (final concentrations range from 10-
0.0195 g/mL). Stock solutions of ligands are prepared in Assay Buffer + 0.2% BSA at
300 nM (30x the final assay concentration of 10 nM). 20 mE of ligand is mixed with 180
mE of antibody in wells of v-bottom 96-well polypropylene plates. Ligand and antibody
are incubated at room temperature for 30 minutes. A cell plate and a ligand-antibody
plate are loaded into a Fluorescent Imagine Plate Reader (FLIPR-3, Molecular Devices)
programmed to transfer 50 m of ligand-antibody to wells of the cell plate. Fluorescence
is recorded every second for 90 seconds. The change in fluorescence (DRFU) is
calculated from images 10 to 90. DRFU versus log (antibody concentration) is plotted
and IC50 values are determined by nonlinear regression using Graph Pad Prism. Assays
are performed in triplicate over three assay plates. Data are expressed as the mean of
replicates.
The results are summarized in Table 5. These results demonstrate that Antibody 1
was able to neutralize all seven human ELR+ CXC chemokines. IC50 values are expressed
as mg/mL of antibody (standard deviations are in parentheses). Both the 72 amino acid
and 77 amino acid forms of CXCL8 were used. Data are average of 2-5 replicates.
Table 5 : In vitro FLIPR study using HMEC cells expressing human CXCR2
In Vitro Neutralization of Human CXCL8 or CXCL1-induced Chemotaxis Using
Primary Human Neutrophils
A chemotaxis assay using human neutrophils was chosen to determine the
neutralizing activity of Antibody 1 in cells naturally expressing both CXCR1 and
CXCR2. Peripheral blood from healthy volunteers is drawn into two 10 mL sodium
heparin tubes. To isolate neutrophils, 5 mL of blood is layered over 5 mL of
Polymorphprep in four 15 mL tubes. The tubes are centrifuged for 30 minutes at 470xg,
18°C. The plasma and top cell band (mononuclear cells) are removed and discarded. The
second band (neutrophils) is pooled from the 4 tubes and an equal volume of PBS is
added. The tube is centrifuged for 10 minutes at 400xg, 18°C. The pellet is washed with
12 mL of PBS, centrifuged as before, and the pellet is re-suspended with 11 mL
HBSS/BSA (7.5 mg/mL BSA, HBSS). 60xl0 6 cells are suspended in 12 mL HBSS/BSA
and 5 mM CMFDA and incubated for 30 min at 37°C. Post-incubation, the tube is
centrifuged to pellet the cells, washed one time with 12 mL HBSS/BSA, and then the
cells are re-suspended in 12 mL HBSS/BSA (5xl0 6 cells/mL).
Antibody 1 and isotype control (human IgG4 antibody) are diluted to 1495 nM
using HBSS/BSA (Dilution 1) and then serially diluted 1:5 with HBSS/BSA. CXCL8 is
diluted to 20 nM with HBSS/BSA. CXCL1 is diluted to 10.1 nM with HBSS/BSA.
70 of Antibody 1 or HBSS/BSA are mixed with 70 of either the CXCL8 or
CXCL1 solution and incubated at room temperature for -30 minutes. 30 m of the
mixture are dispensed into the lower chamber wells of a ChemoTx plate in triplicate.
Wells containing only HBSS/BSA (no chemokine or antibody) will show the background
signal. The ChemoTx filter is placed over the lower chamber and 50 m (250,000 cells)
is dispensed above each well. The ChemoTx plate is incubated for 3 hours at 37°C, 5%
C0 2. After incubation, the cells are rinsed from the top surface with PBS and the
ChemoTx filter is removed. Fluorescence is read (Wallac Victor3 1420 counter) 485/535
using only the bottom detector. The mean fluorescence of the background wells
(HBSS/BSA only) is subtracted from the test well fluorescence, and the mean and
standard deviations are calculated in Excel.
At a CXCL8 concentration of 5 nM, the IC50 for Antibody 1 (MW 150,000 kDa)
was 26.4 (±0.236) nM. At a CXCL8 concentration of 10 nM, the IC50 for Antibody 1 was
43.7 (±0.086) nM. At a CXCL1 concentration of 5 nM, the IC50 for Antibody 1 was 18.5
(±0.158) nM. At a CXCL1 concentration of 20 nM, the IC50 for Antibody 1 was 40.3
(±0.112) nM. At all tested concentrations of CXCL1 and CXCL8, the isotype control
antibody did not affect chemotaxis. The data show that Antibody 1 can block the
chemotactic activity of human CXCL8 or CXCL1 in a dose dependent manner while
chemotactic activity was unaffected by the isotype control antibody.
In Vivo Acute DSS Colitis Model in Mice
Dextran sulfate sodium (DSS) is the most commonly used model of Ulcerative
Colitis (UC). In this model, DSS is a chemical irritant that is added to drinking water to
induce acute disease that resembles UC. The acute phase of DSS colitis is characterized
by the recruitment of neutrophils to the mucosa and submucosa, and increased expression
of ELR+ CXC chemokines. However, chronic exposure to DSS causes severe gut damage
and significant weight loss, which is not suitable in a colitis model. To accommodate the
acute nature of this model, Antibody 1 was used in a prophylactic manner to test its
ability to inhibit the recruitment of neutrophils and the development of colitis. Of note in
this model, mouse CXCL5 (LIX) protein is significantly increased in colon tissue (Kwon
2005); however, Antibody 1 does not neutralize this mouse chemokine.
C57BL/6 mice, 8-10 wks old, weighing 18-22 g, are obtained. Blood is collected
by cardiac puncture and analyzed to establish a baseline. To induce colitis, mice receive
2.5% DSS (MW=36,000-50,000) in the drinking water for 5 days (Days 1-5) followed by
6 days of no DSS water (reflecting acute inflammation). Control healthy mice receive
water only ("no DSS" group). Mice receiving DSS are dosed by subcutaneous injection
on Day 0, 2, 4, and 8 with human IgG4 control antibody (25 mg/kg) or Antibody 1 (25
mg/kg). Body weight is recorded daily. The number of mice used for each treatment is 9
(except 5 healthy mice are used in the healthy "no DSS" group.) The study is performed
in quadruplicate.
As shown in Table 6, DSS mice that received human IgG4 control antibody lost
weight dramatically between Day 5 and Day 8. DSS mice that received Antibody 1 before
induction of colitis and during the acute phase of the disease displayed less weight loss
between Day 5 and Day 8 than those DSS mice treated with human IgG4 control antibody
(94.0% initial body weight for Antibody 1 versus 85.3% initial body weight for IgG4
control on Day 8). These results demonstrate that systemic administration of Antibody 1
effectively mitigated weight loss in DSS-induced colitis, supporting the conclusion that
Antibody 1 neutralizes the activity of certain mouse ELR+ CXC chemokines and
decreases neutrophil recruitment to the colon.
Table 6
In Vivo Neutralization in 786-0 Clear Cell Renal Cell Xenograft Model
786-0 renal cell carcinoma (RCC) cells are mixed 1:1 with matrigel and
implanted subcutaneously in the right rear flank of athymic nude female mice at 3.0 x 106
cells per injection. 786-0 xenograft-bearing mice having tumor volumes that reached
100 mm3 were orally gavaged with 10 mg/kg of sunitinib two times a day under a
continuous dosing regimen until the mice started progressing with tumor growth even
under sunitinib treatment like control-treated mice (IgG4 and 10% vehicle). Mice that
were progressing with tumor growth on sunitinib therapy were randomly divided into 2
groups. One group receives sunitinib at 10 mg/kg two times a day plus control IgG4
antibody at 20 mg/kg once a week. The other group receives suninitib at 10 mg/kg two
times a day plus Antibody 1 at 20 mg/kg once a week. Average tumor volumes (standard
error in parentheses) are shown in Table 7. The addition of Antibody 1 to sunitinib
treatment reduced tumor growth significantly over time (p<0.0001), indicating that
Antibody 1 resensitized clear cell RCC tumors to sunitinib treatment.
Table 7
In Vivo Neutralization in SKOV3-Luc Ovarian Cancer Xenograft Model
SKOV3-Luc is a human ovary cancer cell line that expresses firefly luciferase
gene. SKOV3-Luc cells are often used in vivo to establish human ovarian
adenocarcinoma tumor growth.
SKOV3-Luc ovarian cancer cells were mixed 1:1 with matrigel and implanted
subcutaneously in the right rear flank of athymic nude female mice at 3.0 x 106 cells per
injection. Mice were randomized into 4 groups at baseline according to tumor volume
after the xenografts were grown to an average tumor volume of 200 mm3. Mice received
either control IgG4 antibody (2.5 mg/kg once a week), cisplatin (2.5 mg/kg once a week),
Antibody 1 (20 mg/kg once a week), or a combination of cisplatin (2.5 mg.kg once a
week) and Antibody 1 (20 mg/kg once a week) by intraperitoneal injection. Tumor
growth is shown in Table 8. Cisplatin monotherapy did not show statistically significant
tumor growth inhibition compared to isotype control. However, the combination of
cisplatin and Antibody 1 showed statistically significant tumor growth inhibition
(p£0.001) compared to isotype control and cisplatin monotherapy, indicating that
Antibody 1 synergistically augments chemotherapy in the SKOV3-Luc ovarian cancer
xenograft model.
Table 8
Sequences
Antibody 1 Heavy chain amino acid sequence: SEQ ID NO: 1
QVQLVQSGAEVKKPGASVKVSCKASGYEFTSYWIHWVRQAPGQGLEWMGNISP
NSGSANYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREGPYSYYPS
REYYGSDLWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSN
TKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS
QEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY
KCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSLG
Antibody 1 Heavy chain variable region: SEQ ID NO: 2
QVQLVQSGAEVKKPGASVKVSCKASGYEFTSYWIHWVRQAPGQGLEWMGNISP
NSGSANYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREGPYSYYPS
REYYGSDLWGQGTLVTVSS
Antibody 1 Light chain amino acid sequence: SEQ ID NO: 3
EIVLTQSPATLSLSPGERATLSCRASQSISNNLHWYQQKPGQAPRLLIYYTSRSVS
GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCGQNNEWPEVFGGGTKVEIKRTVAA
PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Antibody 1 Light chain variable region: SEQ ID NO: 4
EIVLTQSPATLSLSPGERATLSCRASQSISNNLHWYQQKPGQAPRLLIYYTSRSVS
GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCGQNNEWPEVFGGGTKVEIK
Antibody 1 Heavy chain DNA sequence: SEQ ID NO: 5
CAGGTGCAGCTGGTGCAGTCTGGTGCTGAAGTGAAGAAGCCTGGGGCCTCAG
TGAAGGTGTCCTGCAAGGCATCTGGCTACGAGTTCACCAGCTACTGGATTCAC
TGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAAATATTTCTC
CTAATAGTGGTAGTGCTAACTACAATGAGAAGTTCAAGAGCAGAGTCACCAT
GACCAGGGACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGA
TCTGAGGACACGGCCGTGTATTACTGTGCGAGAGAGGGCCCTTACAGTTATTA
TCCGAGTAGGGAGTACTATGGCTCTGACCTCTGGGGGCAAGGGACCCTAGTC
ACAGTCTCCTCAGCCTCCACCAAGGGCCCATCGGTCTTCCCGCTAGCGCCCTG
CTCCAGGAGCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGAC
TACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCG
GCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGC
AGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCA
ACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGTCCA
AATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCCTGGGGGGACCA
TCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTCTCATGATCTCCCGGAC
CCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCAGGAAGACCCCGAGGTC
CAGTTCAACTGGTACGTGGATGGCGTGGAGGTGCATAATGCCAAGACAAAGC
CGCGGGAGGAGCAGTTCAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGT
CCTGCACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAAC
AAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGC
CCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAA
GAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATC
GCCGTGGAGTGGGAAAGCAATGGGCAGCCGGAGAACAACTACAAGACCACG
CCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACCGT
GGACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTGATGCAT
GAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGT
Antibody 1 Light chain DNA sequence: SEQ ID NO: 6
GAAATTGTGTTGACACAGTCTCCAGCCACCCTGTCTTTGTCTCCAGGGGAAAG
AGCCACCCTCTCCTGCAGGGCCAGTCAAAGTATCAGCAATAACCTACACTGG
TACCAACAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATTATACTTCCCG
GTCCGTCTCTGGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACT
TCACTCTCACCATCAGCAGCCTAGAGCCTGAAGATTTTGCAGTTTATTACTGT
GGACAGAATAACGAGTGGCCTGAGGTGTTCGGCGGAGGGACCAAGGTGGAG
ATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGA
GCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATC
CCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAA
CTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTC
AGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTAC
GCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCA
ACAGGGGAGAGTGC
Antibody 1/Antibody 2 LCDR1: SEQ ID NO: 7
RASQSISNNLH
Antibody 1/Antibody 2 LCDR2: SEQ ID NO: 8
YTSRSVS
Antibody 1/Antibody 2 LCDR3: SEQ ID NO: 9
GQNNEWPEV
Antibody 1/Antibody 2 HCDR1: SEQ ID NO: 10
GYEFTSYWIH
Antibody 1/Antibody 2 HCDR2: SEQ ID NO: 11
NISPNSGSANYNEKFKS
Antibody 1 HCDR3: SEQ ID NO: 12
EGPYSYYPSREYYGSDL
Antibody 2 Heavy chain amino acid sequence: SEQ ID NO: 13
QVQLVQSGAEVKKPGASVKVSCKASGYEFTSYWIHWVRQAPGQGLEWMGNISP
NSGSANYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREGPYSYYPS
RQYYGSDLWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSN
TKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS
QEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEY
KCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMH
EALHNHYTQKSLSLSLG
Antibody 2 Heavy chain variable region: SEQ ID NO: 14
QVQLVQSGAEVKKPGASVKVSCKASGYEFTSYWIHWVRQAPGQGLEWMGNISP
NSGSANYNEKFKSRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAREGPYSYYPS
RQYYGSDLWGQGTLVTVSS
Antibody 2 Light chain amino acid sequence: SEQ ID NO: 15
EIVLTQSPATLSLSPGERATLSCRASQSISNNLHWYQQKPGQAPRLLIYYTSRSVS
GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCGQNNEWPEVFGGGTKVEIKRTVAA
PSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQD
SKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
Antibody 2 Light chain variable region: SEQ ID NO: 16
EIVLTQSPATLSLSPGERATLSCRASQSISNNLHWYQQKPGQAPRLLIYYTSRSVS
GIPARFSGSGSGTDFTLTISSLEPEDFAVYYCGQNNEWPEVFGGGTKVEIK
Antibody 2 Heavy chain DNA sequence: SEQ ID NO: 17
CAGGTGCAGCTGGTGCAGTCTGGTGCTGAAGTGAAGAAGCCTGGGGCCTCAG
TGAAGGTGTCCTGCAAGGCATCTGGCTACGAGTTCACCAGCTACTGGATTCAC
TGGGTGCGACAGGCCCCTGGACAAGGGCTTGAGTGGATGGGAAATATTTCTC
CTAATAGTGGTAGTGCTAACTACAATGAGAAGTTCAAGAGCAGAGTCACCAT
GACCAGGGACACGTCCACGAGCACAGTCTACATGGAGCTGAGCAGCCTGAGA
TCTGAGGACACGGCCGTGTATTACTGTGCGAGAGAGGGCCCTTACAGTTATTA
TCCGAGTAGGCAGTACTATGGCTCTGACCTCTGGGGGCAAGGGACCCTAGTC
ACAGTCTCCTCAGCCTCCACCAAGGGCCCATCGGTCTTCCCGCTAGCGCCCTG
CTCCAGGAGCACCTCCGAGAGCACAGCCGCCCTGGGCTGCCTGGTCAAGGAC
TACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGCG
GCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGC
AGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACGAAGACCTACACCTGCA
ACGTAGATCACAAGCCCAGCAACACCAAGGTGGACAAGAGAGTTGAGTCCA
AATATGGTCCCCCATGCCCACCCTGCCCAGCACCTGAGTTCCTGGGGGGACCA
TCAGTCTTCCTGTTCCCCCCAAAACCCAAGGACACTCTCATGATCTCCCGGAC
CCCTGAGGTCACGTGCGTGGTGGTGGACGTGAGCCAGGAAGACCCCGAGGTC
CAGTTCAACTGGTACGTGGATGGCGTGGAGGTGCATAATGCCAAGACAAAGC
CGCGGGAGGAGCAGTTCAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGT
CCTGCACCAGGACTGGCTGAACGGCAAGGAGTACAAGTGCAAGGTCTCCAAC
AAAGGCCTCCCGTCCTCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGC
CCCGAGAGCCACAGGTGTACACCCTGCCCCCATCCCAGGAGGAGATGACCAA
GAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTACCCCAGCGACATC
GCCGTGGAGTGGGAAAGCAATGGGCAGCCGGAGAACAACTACAAGACCACG
CCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAGGCTAACCGT
GGACAAGAGCAGGTGGCAGGAGGGGAATGTCTTCTCATGCTCCGTGATGCAT
GAGGCTCTGCACAACCACTACACACAGAAGAGCCTCTCCCTGTCTCTGGGT
Antibody 2 Light chain DNA sequence: SEQ ID NO: 18
GAAATTGTGTTGACACAGTCTCCAGCCACCCTGTCTTTGTCTCCAGGGGAAAG
AGCCACCCTCTCCTGCAGGGCCAGTCAAAGTATCAGCAATAACCTACACTGG
TACCAACAGAAACCTGGCCAGGCTCCCAGGCTCCTCATCTATTATACTTCCCG
GTCCGTCTCTGGCATCCCAGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGACT
TCACTCTCACCATCAGCAGCCTAGAGCCTGAAGATTTTGCAGTTTATTACTGT
GGACAGAATAACGAGTGGCCTGAGGTGTTCGGCGGAGGGACCAAGGTGGAG
ATCAAACGAACTGTGGCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGA
GCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGAATAACTTCTATC
CCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAA
CTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTC
AGCAGCACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTAC
GCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCA
ACAGGGGAGAGTGC
Antibody 2 HCDR3: SEQ ID NO: 19
EGPYSYYPSRQYYGSDL
HCDR3 Consensus Sequence: SEQ ID NO: 20
EGPYSYYPSRXaaYYGSDL
wherein Xaa is E or Q
Human Gro-alpha (CXCL1): SEQ ID NO: 21
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPA
SPIVKKIIEKMLNSDKSN
Human Gro-beta (CXCL2): SEQ ID NO: 22
APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPA
SPMVKKIIEKMLKNGKSN
Human Gro-gamma (CXCL3): SEQ ID NO: 23
ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPA
SPMVQKIIEKILNKGSTN
Human ENA-78 (CXCL5): SEQ ID NO: 24
AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPE
APFLKKVIQKILDGGNKEN
Human GCP-2 (CXCL6): SEQ ID NO: 25
VSAVLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCLD
PEAPFLKKVIQKILDSGNKKN
Human NAP-2 (CXCL7): SEQ ID NO: 26
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIK
KIVQKKLAGDESAD
Human IL-8 (CXCL8): SEQ ID NO: 27
SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENW
VQRVVEKFLKRAENS

WE CLAIM:
1. An antibody that neutralizes human Gro-alpha, Gro-beta, Gro-gamma, ENA-78,
GCP-2, NAP-2, and IL-8.
2. The antibody of claim 1, wherein the antibody binds IL-8 (SEQ ID NO: 27) at the
following amino acids: Arg 6, e 10, Arg 35, e 40.
3. The antibody of claim 2, wherein the antibody further binds IL-8 (SEQ ID NO:
27) at Leu 49.
4. The antibody according to any of claims 1-3, wherein the antibody comprises a
light chain, wherein the light chain comprises a light chain variable region
(LCVR), wherein the LCVR comprises LCDR1 (RASQSISNNLH (SEQ ID NO:
7)), LCDR2 (YTSRSVS (SEQ ID NO: 8)), and LCDR3 (GQNNEWPEV (SEQ ID
NO: 9)) and a heavy chain, wherein the heavy chain comprises a heavy chain
variable region (HCVR), wherein the HCVR comprises HCDR1 (GYEFTSYWIH
(SEQ ID NO: 10)), HCDR2 (NISPNSGSANYNEKFKS (SEQ ID NO: 11)), and
HCDR3 (EGPYSYYPSRXaaYYGSDL (SEQ ID NO: 20)) wherein Xaa is E or Q.
5. The antibody according to any of claims 1-4, wherein the amino acid sequence of
the LCVR is SEQ ID NO: 4 or 16 and the HCVR is SEQ ID NO: 2 or SEQ ID
NO: 14.
6. The antibody according to any of claims 1-5, wherein the antibody comprises a
light chain and a heavy chain, wherein the amino acid of the light chain is SEQ ID
NO: 3 or 15, and wherein the amino acid of the heavy chain is SEQ ID NO: 1 or
13.
7. An antibody that binds human Gro-alpha, Gro-beta, Gro-gamma, ENA-78, GCP-
2, NAP-2, and IL-8, the antibody comprising a light chain and a heavy chain,
wherein the light chain comprises a light chain variable region (LCVR) and the
heavy chain comprises a heavy chain variable region (HCVR), wherein the LCVR
comprises LCDR1, LCDR2, LCDR3 and the HCVR comprises HCDR1, HCDR2,
HCDR3, wherein LCDR1 is RASQSISNNLH (SEQ ID NO: 7), LCDR2 is
YTSRSVS (SEQ ID NO: 8), LCDR3 is GQNNEWPEV (SEQ ID NO: 9), HCDR1
is GYEFTSYWIH (SEQ ID NO: 10), HCDR2 is NISPNSGSANYNEKFKS (SEQ
ID NO: 11), and HCDR3 is EGPYSYYPSRXaaYYGSDL (SEQ ID NO: 20)
wherein Xaa is E or Q.
8. The antibody of Claim 7, wherein the amino acid sequence of the HCVR is SEQ
ID NO: 2 or SEQ ID NO: 14.
9. The antibody of Claim 7, wherein the amino acid sequence of the LCVR is SEQ
ID NO: 4 or 16.
10. The antibody of Claim 7, wherein the amino acid sequence of the HCVR is SEQ
ID NO: 2 and the amino acid sequence of the LCVR is SEQ ID NO: 4.
11. The antibody of claim 7, wherein the amino acid sequence of the heavy chain is
SEQ ID NO: 1 and the amino acid sequence of the light chain is SEQ ID NO: 3.
12. The antibody of claim 7, wherein the antibody comprises two heavy chains having
the amino acid sequence of SEQ ID NO: 1 and two light chains having the amino
acid sequence of SEQ ID NO: 3.
13. A DNA molecule comprising a first polynucleotide sequence encoding a
polypeptide having the amino acid sequence of SEQ ID NO: 1 or 13; and
comprising a second polynucleotide sequence encoding a polypeptide having the
amino acid sequence of SEQ ID NO: 3 or 15.
14. A mammalian cell comprising the DNA molecule of Claims 13, wherein the cell
is capable of expressing an antibody of any of Claims 1-12.
15. A process for producing an antibody according to any of claims 1-12, the process
comprising cultivating the mammalian cell of Claim 14 under conditions such that
the antibody is expressed, and recovering the expressed antibody.
16. An antibody produced by the process of Claim 15.
17. A method of treating ulcerative colitis, renal cancer, or ovarian cancer in a patient,
comprising administering to the patient a therapeutically effective amount of an
antibody according to any of claims 1-12 and 16.
18. An antibody according to any of claims 1-12 and 16 for use in therapy.
19. An antibody according to any of claims 1-12 and 16 for use in the treatment of
ulcerative colitis, renal cancer, or ovarian cancer.

Documents

Application Documents

# Name Date
1 Form 5 [07-08-2015(online)].pdf 2015-08-07
2 Form 3 [07-08-2015(online)].pdf 2015-08-07
3 Description(Complete) [07-08-2015(online)].pdf 2015-08-07
4 6987-DELNP-2015.pdf 2015-08-08
5 6987-delnp-2015-Correspondence Others-(18-08-2015).pdf 2015-08-18
6 6987-delnp-2015-Assignment-(18-08-2015).pdf 2015-08-18
7 Marked Copy [19-08-2015(online)].pdf 2015-08-19
8 Form 13 [19-08-2015(online)].pdf 2015-08-19
9 Description(Complete) [19-08-2015(online)].pdf 2015-08-19
10 Other Document [24-08-2015(online)].pdf 2015-08-24
11 Form 13 [24-08-2015(online)].pdf 2015-08-24
12 6987-delnp-2015-X19897 sequence listing PCT National_ST25-(25-08-2015).pdf 2015-08-25
13 6987-delnp-2015-Correspondence Other-(25-08-2015).pdf 2015-08-25
14 6987-delnp-2015-GPA-(27-08-2015).pdf 2015-08-27
15 6987-delnp-2015-Correspondence Others-(27-08-2015).pdf 2015-08-27
16 6987-delnp-2015-Form-3-(28-01-2016).pdf 2016-01-28
17 6987-delnp-2015-Correspondence Others-(28-01-2016).pdf 2016-01-28
18 6987-DELNP-2015-FER.pdf 2018-11-29
19 6987-DELNP-2015-FORM 3 [25-04-2019(online)].pdf 2019-04-25
20 6987-DELNP-2015-PETITION UNDER RULE 137 [22-05-2019(online)].pdf 2019-05-22
21 6987-DELNP-2015-OTHERS [23-05-2019(online)].pdf 2019-05-23
22 6987-DELNP-2015-FER_SER_REPLY [23-05-2019(online)].pdf 2019-05-23
23 6987-DELNP-2015-CORRESPONDENCE [23-05-2019(online)].pdf 2019-05-23
24 6987-DELNP-2015-COMPLETE SPECIFICATION [23-05-2019(online)].pdf 2019-05-23
25 6987-DELNP-2015-CLAIMS [23-05-2019(online)].pdf 2019-05-23
26 6987-DELNP-2015-ABSTRACT [23-05-2019(online)].pdf 2019-05-23
27 6987-DELNP-2015-FORM 3 [03-09-2020(online)].pdf 2020-09-03
28 6987-DELNP-2015-PatentCertificate09-09-2020.pdf 2020-09-09
29 6987-DELNP-2015-IntimationOfGrant09-09-2020.pdf 2020-09-09

Search Strategy

1 6987searchstrgy_15-11-2018.pdf

ERegister / Renewals

3rd: 03 Nov 2020

From 05/03/2016 - To 05/03/2017

4th: 03 Nov 2020

From 05/03/2017 - To 05/03/2018

5th: 03 Nov 2020

From 05/03/2018 - To 05/03/2019

6th: 03 Nov 2020

From 05/03/2019 - To 05/03/2020

7th: 03 Nov 2020

From 05/03/2020 - To 05/03/2021

8th: 25 Feb 2021

From 05/03/2021 - To 05/03/2022

9th: 01 Mar 2022

From 05/03/2022 - To 05/03/2023

10th: 02 Mar 2023

From 05/03/2023 - To 05/03/2024

11th: 07 Mar 2024

From 05/03/2024 - To 05/03/2025

12th: 28 Feb 2025

From 05/03/2025 - To 05/03/2026

13th: 23 Feb 2026

From 05/03/2026 - To 05/03/2027