Sign In to Follow Application
View All Documents & Correspondence

"Platelet Glycoprotein 1 B Alpha Variant Fusion Polypeptides And Methods Of Use Thereof"

Abstract: The present invention provides compositions and methods for treating or preventing vascular-associated disorders.

Get Free WhatsApp Updates!
Notices, Deadlines & Correspondence

Patent Information

Application #
Filing Date
19 December 2005
Publication Number
48/2007
Publication Type
INA
Invention Field
BIOTECHNOLOGY
Status
Email
Parent Application

Applicants

WYETH
FIVE GIRALDA FARMS, MADISON, NJ 07940, U.S.A.

Inventors

1. GRAY SHAW
8 LANCESTER LANE, MILTON, MA 01286, U.S.A.
2. DIANNE S. SAKO
14 MYSTIC STREET, MEDFORD, MA 02155, U.S.A.
3. RAVINDRA KUMAR
421 ARLINGTON STREET, ACTON, MA 01720, U.S.A.
4. JIN XU
47 KELLY ROAD, DRACUT, MA 01826, U.S.A.

Specification

This invention relates to an isolated polypeptide.
BACKGROUND OF THE INVENTION
The deleterious effects of vascular-associated disorders such as stroke, heart attack, and artherosclerosis are thought to be caused, at least in part, by the inappropriate triggering of a vascular inflammation and repair response. The vascular inflammation and repair response involves adhesive interactions between various cell types normally found freely circulating in blood. Examples of such interactions include those that can occur between platelets, leukocytes and the inner wall of blood vessels (i.e., the vascular endotheliurn). Under conditions of high fluid shear forces, platelets adhere to the endothelium via an interaction between the glycoprotein (GP) Ib-IX-V complex on their surface and von Willebrand factor (vWF) present on exposed vessel subendqthelium. In addition, platelets adhering to the vascular endothelium can bind and capture freely circulating platelets via vWF-mediated tethering, enabling thrombus growth through successive layers of platelets. The GPIboc chain of the GPIb-IX-V complex can also facilitate the binding of a-thrombin to the platelet surface, enhancing the thrombin-mediated cleavage of GPV and protease-activated receptors (PARs).
In pontrast, leukocytes can adhere to activated endothelium either directly, or indirectly by first adhering to vWF-immobilized platelets. In both instances, leukocyte cell surface molecules that bind to either the selectin or integrin classes of adhesion receptors mediate these adhesion events. Leukocyte-platelet adhesion is thought to occur, in part, via interaction of the leukocyte surface integrin molecule MacI and the GPlb component of the platelet surface GPIb-K-V complex.
In response to vascular disturbances such as atherosclerotic plaque rupture or mechanical injury, e.g., such as that caused by angioplasty, stent placement, cardiopulmonary bypass procedures, ischemic damage or stenosis, leukocytes and platelets can accumulate at a vascular lesion site and provide multiple adhesive substrates for one another. This accumulation of leukocytes and platelets leads to the local production of factors including, e.g., mitogens, cytokines and chemokines, causing the further undesirable progression of a vascular disease.
Therapeutic polypeptides including a vWF-binding region derived from GPIba have been described. One such polypeptide is based on a sequence containing two amino acid substitutions (G233V M239V) in the amino acid sequence of wild-type human GPIba. An Ig fusion protein containing 290 amino acids of the extracellular, vWF-binding domain of this variant (named GPIb2V-Ig) of this variant inhibits coronary artery thrombosis.
SUMMARY OF THE INVENTION
The invention provides improved glycoprotein-Iba variant polypeptides that are useful as therapeutic agents for treating vascular disorders. In various embodiments, the variants show decreased aggregation, enhanced stability, decreased binding to thrombin, or two or more of these properties. One use for the glycoprotein-Iba-protein variant polypeptides is as a fusion protein to treat vascular conditions associated with vascular inflammation, thrombosis, atherosclerosis, and angioplasty-related restenosis.
In one aspect, the polypeptide binds with lower affinity to alpha thrombin relative to binding to alpha thrombin of a polypeptide that includes the naturally occurring amino acid sequence of human GPIbcc(SEQ ID NO:1) or a polypeptide, termed GPIb2V (SEQ ID NO:2), which includes the amino acid substitutions G233V and M239V relative to the amino acid sequence of SEQ ID NO: 1. When the polypeptide binds with low affinity to thrombin, more thrombin is made available for thrombus formation, and undesirable bleeding in a subject is minimized. Examples of polypeptides that show reduced thrombin binding are polypeptides that include one, two, or three of the amino acid substitutions Y276F, Y278F, Y279V, or a conservative variant thereof, relative to the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2.
In some embodiments, aggregation of the polypeptide is lowered relative to aggregation of a polypeptide that includes the amino acid sequence of human SEQ ID NO:1 or SEQ ID NO:2. In
some embodiments, decreased aggregation is observed during synthesis of the polypeptide in a cell. An example of a polypeptide that shows decreased aggregation is a polypeptide that includes the amino acid substitution C65S, or a conservative variant thereof, relative to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
In some embodiments, the polypeptide is more resistant to proteolysis than a polypeptide that includes the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2. An example of such a polypeptide is a polypeptide includes the amino acid substitution K237V, or a conservative variant thereof, relative to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
Examples of suitable polypeptides are those that have the following amino acid sequence substitutions relative to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2:Y276F, Y276F K237V,Y276F C65S, Y276F Y278F Y279F, Y276F Y278F Y279F K237V and Y276F Y278F Y279FK237VC65S.
The polypeptides of the invention can be provided as fusion proteins. For example, the glycoprotein Ibcc fusion protein can include a first polypeptide, comprising at least a region of a glycoprotein Ibcc polypeptide variant, linked to a second polypeptide. In some embodiments., the second polypeptide forms a multimer, e.g., a dimer. In some embodiments, the second polypeptide includes at least a region of an immunoglobulin polypeptide.
Also provided by the invention is a nucleic acid encoding the glycoprotein-Iba variant polypeptide, as well as vectors, cells and methods of expressing the glycoprotein-Iba variant polypeptide using glycoprotein-Iba variant polypeptide-encoding nucleic acids. The invention additionally includes a nucleic acid encoding a glycoprotein Iba variant fusion polypeptide, as well as a vector containing glycoprotein Iba fusion polypeptide-encoding nucleic acids described herein, and a cell containing the vectors or nucleic acids described herein.
Also provided by the invention is a method of inhibiting leukocyte adhesion to a biological tissue by contacting a leukocyte with a glycoprotein Iba fusion polypeptide. The leukocyte is contacted in an amount sufficient to inhibit adherence of the leukocyte and the biological tissue
In another aspect, the invention provides a method of treating a disorder associated with platelet activation. The method includes administering to a subject an effective amount of a glycoprotein Iba fusion polypeptide.
Also included in the invention are pharmaceutical compositions that include glycoprotein Iba variant polypeptides, or glycoprotein Iba variant fusion polypeptides.
Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.
Other features and advantages of the invention will be apparent from the following detailed description, and from the claims.
BRIEF DESCRIPTION OF THE DRAWINGS
FIG. 1 is a graph showing inhibition of GPIba chimeras on ristocetin-induced human platelet aggregation. Shown is light transmittance (y-axis) for wild-type GPIba ("Normal"), and GPIb-Ig WT, GPIba-290/2V-Ig, GPIba-290/2V/FFF-Ig chimeras.
FIG. 2 is a graph showing the antithrombotic efficacy of GPIba chimeras in a canine Folts' model of coronary thrombosis (y-axis: LCX blood).
FIG. 3 is a graph showing inhibition of platelet function by GPIb/290/2V-Ig and GPIb/290/2V/FFF-Ig in a canine model of coronary thrombosis assessed by PFA-100.
DETAILED DESCRIPTION OF THE INVENTION,
Glycoprotein Iba-derived polypeptides with decreased binding to alpha thrombin, decreased aggregation and/or increased resistance to proteolysis according to the invention are useful as therapeutic agents in, e.g., treating various conditions that benefit by inhibiting binding of activated
platelet cells to vWF on vascular cells. In some embodiments, the polypeptides are provided as fusion proteins.
The protein variants of the invention with decreased thrombin binding advantageously result in decreased bleeding. Binding of thrombin to the platelet GPIba receptor is necessary for clotting. Thrombin binding to a therapeutic soluble GPIb can augment bleeding in vivo by sequestering thrombin away from the platelet GPIba receptor, thus reducing thrombin-induced platelet aggregation. Thus, the protein variants that show lower affinity for thrombin make the thrombin available to interact with the platelet IBa receptor, which in turn promotes clotting.
A suitable polypeptide includes an amino acid sequence with one to 15 amino acid substitutions, deletions or insertions relative to amino acids in the region between, and including, amino acids 65-279 of a naturally occurring human GPIba protein sequence shown in SEQ ID NO:1, below, or of the variant GPIb2V, whose amino acid sequence is shown in SEQ ID NO:2, below. In one or more embodiments, the polypeptide has one or more of the following activities: (i) lower affinity binding to alpha thrombin relative to binding to alpha thrombin of a polypeptide that includes the amino acid sequence of human SEQ ID NO:1 or SEQ ID NO:2; (ii) lower aggregation relative to aggregation of a polypeptide that includes the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2; or (iii) increased resistance to proteolysis relative to a polypeptide that includes the amino acid sequence of SEQ ID N0:l or SEQ ID NO:2.
While not wishing to be bound by theory, it is believed that these properties are based on the results of substitutions at targeted regions in the polypeptide sequence of the GPIB2V variant (SEQ ID NO:2). The change from cysteine to serine residue at position 65 (i.e., C65S) leads to inhibition of aggregation of the GPIba molecule, in particular during a recombinant production process. The tyrosine residues found at positions 276, 278, and 279 in the wild-type sequence are normally posttranslationally modified to sulfotyrosine, which creates an anionic electrostatic interaction with alpha thrombin. Selective elimination of these tyrosine residues by converting them to phenylalanine (i.e., Y276F, Y278F, and Y279F substitutions) reduces binding to alpha thrombin (Marchese et al., J. Biol. Chem. 270:9571-78), while retaining the desired binding to vWF. A lysine to valine substitution at position 237 will prevent proteolysis at this site during the recombinant production process.
A 290 amino acid sequence fragment of a naturally occurring human glycoprotein Iba chain is set forth below:
(Sequance Removed)
The amino acid sequence of the GPIb2Vvariant is provided below as SEQ ID NO:2. This variant is also discussed in US patent application publication number 20030091576, and its counterpart WO 02/063003.
(Sequance Removed)
In some embodiments, the polypeptide has no more than 12 substitutions, insertions, or deletions relative to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2. For example, it may have 10, 8,7, 6, 5 or fewer substitutions, insertions, or deletions relative to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2. In some embodiments, the substitutions, insertions, or deletions are in the region between amino acids 65 and 279, inclusive.
In some embodiments, the polypeptide binds with lower affinity to alpha thrombin relative to binding to alpha thrombin of a polypeptide that includes the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2. Examples of polypeptides that show reduced binding are polypeptides that include one, two, or three of the amino acid substitutions Y276F, Y278F, Y279V, or a conservative variant thereof, relative to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
In some embodiments aggregation of the polypeptide is lowered relative to aggregation of a polypeptide that includes the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2. In some embodiments, decreased aggregation is observed during synthesis of the polypeptide in a cell. An example of a polypeptide that shows decreased aggregation is a polypeptide that includes the amino acid substitution C65S, or a conservative variant thereof, relative to the amino acid sequence of SEQ IDNO:lorSEQIDNO:2.
In some embodiments, the polypeptide is more resistant to proteolysis than a polypeptide that includes the amino acid sequence of SEQ ID NO: 1 or SEQ ID NO:2. An example of such a polypeptide is a polypeptide includes the amino acid substitution K237V, or a conservative variant thereof, relative to the amino acid sequence of SEQ ID N0:l or SEQ ID NO:2.
In some embodiments, the polypeptide includes an amino acid sequence with one to 10 amino acid substitutions, insertions, or deletions relative to amino acids 1-290 of SEQ ID NO:1 or SEQ ID NO:2, provided that at least one of the amino acid substitutions is C65S, K237V,Y276F Y278F, Y279F, K237V.
Examples of suitable polypeptides are those that have the following amino acid sequence substitutions relative to the amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2: Y276F, Y276F K237V,Y276F C65S, Y276F Y278F Y279F, Y276F Y278F Y279F K237V and Y276F Y278F Y279F K237V C65S.
The invention also includes polypeptides with one or more, e.g., 2, 3, 5, 6, 8, 10, 15 or more amino acid substitutions in polypeptides derived from glycoprotein IBa sequences in addition to those corresponding to SEQ ID NO:1 and SEQ ID NO:2. These include, e.g., GPIb302 (SEQ ID N0:3), GPIb302/2A (SEQ ID NO:4) GPIb/4X (SEQ ID N0:5), and GBIb290/l A (SEQ ID NO:6).
(Sequance Removed)
A glycoprotein protein variant can be provided as part of a fusion protein. For example, glycoprotein Iba protein-immunoglobulin fusion proteins are useful for inhibiting adherence of platelets and leukocytes to biological tissues, such as for example the vascular endothelium. The fusion proteins of the invention, or nucleic acids encoding these fusion proteins, can be incorporated into pharmaceutical compositions and administered to a subject to inhibit an interaction between an glycoprotein Iba ligand (such as von Willebrand Factor, Mac-1, P-selectin or thrombin) and an glycoprotein Iba protein on the surface of a cell, such as a platelet. Inhibition of binding suppresses glycoprotein Iba protein -mediated platelet aggregation and associated signal transduction in vivo.
The glycoprotein Iba protein-immunoglobulin fusion proteins can be used to modulate the bioavailability of a glycoprotein Iba protein cognate ligand. Inhibition of the glycoprotein Iba protein ligand/glycoprotein Iba protein interaction are useful therapeutically/or, inter alia, the treatment of vascular inflammation and other vascular disorders associated with platelet activation.
Glycoprotein Variant Iba Fusion Polypeptides
In various aspects the invention provides fusion proteins that include a first polypeptide containing at least a portion of a glycoprotein Iba polypeptide variant operatively linked to a second polypeptide. As used herein, a glycoprotein Iba "fusion protein" or "chimeric protein" includes at least a portion of a glycoprotein Iba polypeptide variant operatively linked to a non-glycoprotein Iba polypeptide. An "glycoprotein Iba polypeptide" or "glycoprotein Iba polypeptide variant" refers to a polypeptide having an amino acid sequence corresponding to at least a portion of a glycoprotein Iba polypeptide, whereas a "non-glycoprotein Iba polypeptide" refers to a polypeptide having an amino acid sequence corresponding to a protein that is not substantially homologous to the
glycoprotein Iba protein, e.g., a protein that is different from the glycoprotein Iba polypeptide or fragment and that is derived from the same or a different organism. Within a glycoprotein Iba fusion protein the glycoprotein Iba polypeptide can correspond to all or a portion of an Iba protein.
In one embodiment, a glycoprotein Iba fusion protein comprises at least one biologically active portion of a glycoprotein Iba protein. In another embodiment, a glycoprotein Iba fusion protein comprises at least two biologically active portions of a glycoprotein Iba protein. In yet another embodiment, a glycoprotein Iba fusion protein comprises at least three biologically active portions of a glycoprotein Iba protein. Within the fusion protein, the term "operatively linked" is intended to indicate that the first and second polypeptides are linked in a manner that allows for at least one function associated with a glycoprotein Iba polypeptide. When used to refer to nucleic acids encoding a glycoprotein Iba fusion polypeptide, the term operatively linked means that a nucleic acid encoding the glycoprotein Iba polypeptide and the non-glycoprotein Iba polypeptide are fused in-frame to each other. The non-glycoprotein Iba polypeptide can be fused to the N-terminus or C-terminus of the glycoprotein Iba polypeptide.
In a further embodiment, the glycoprotein Iba fusion protein may be linked to one or more additional moieties. For example, the glycoprotein Iba fusion protein may additionally be linked to a GST fusion protein in which the glycoprotein Iba fusion protein sequences are fused to the C-terminus of the GST (i.e., glutathione S-transferase) sequences. Such fusion proteins can facilitate the purification of glycoprotein Iba fusion protein.
In another embodiment, the .fusion protein includes a heterologous signal sequence (i.e., a polypeptide sequence that is not present in a polypeptide encoded by a glycoprotein Iba nucleic acid) at its N-terminus. For example, the native glycoprotein Iba signal sequence can be removed and replaced with a signal sequence from another protein, hi certain host cells (e.g., mammalian host cells), expression and/or secretion of glycoprotein Iba can be increased through use of a heterologous signal sequence. A representative signal sequence is MPLLLLLLLLPSPLHP (SEQ ID NO:8). Another representative signal sequence is MPLQLLLLLI LLGPGNSLQL WDTWADEAEK ALGPLLARDRR . (SEQ ID NO:9). If desired, one or more amino acids can additionally be inserted between the first polypeptide moiety comprising the GP Iba moiety and the second polypeptide moiety.
An cbimeric or fusion protein of the invention can be produced by standard recombinant DNA techniques. Nucleic acid sequences encoding GPIba polypeptides, as well as the amino acid sequences of these polypeptides, from which variant GPIba polypeptide variants are constructed are disclosed in WO02/063003, the contents of which are incorporated herein by reference in their entirety.
For example, DNA fragments coding for the polypeptide variant sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, for example, Ausubel et al. (eds.) CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992). Moreover, many expression vectors are commercially available that encode a fusion moiety (e.g., an Fc region of an immunoglobulin heavy chain). A glycoprotein Iba encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the immunoglobulin protein.
Glycoprotein Iba fusion polypeptides may exist as oligomers, such as dimers or trimers. In some embodiments, the glycoprotein Iba fusion polypeptide is a dimer.
In some embodiments, the GP Ib a polypeptide moiety is provided as a variant GP Ib a polypeptide having a mutation in the naturally-occurring GP Ib a sequence (wild type) that results in higher affinity (relative to the non-mutated sequence) binding of the GP ipa polypeptide to a leukocyte cell surface molecule. For example, the mutant polypeptide may bind with higher affinity to von Willebrand factor (vWF). This increased reactivity, or hyperresponsiveness, can be assessed using low concentrations of ristocetin. Alternately, any otheissuitable means for determining the reactivity of the polypeptide with vWF can also be utilized to identify polypeptides which are "more" reactive with vWF, /. e. more reactive than naturally-occurring wild-type GP Iba. Examples of GP Ib a polypeptide valiants that bind with higher affinity to vWF include GP Iba variants that include sequence alterations in the hinge region of a GP Iba polypeptide. The hinge region is
defined as the region including residues 220 to 310 and is reported to be a major binding site for vWF within the GP Ib a polypeptide. Mutations in the hinge region include those at residue 233, which in the wild-type GP Ib a encodes glycine. An example of a suitable substitution of is one in which the glycine at position 233 is replaced with valine (i.e., G233V). A second site for mutation at the hinge region is at residue 239, which in the wild-type GP Ib a encodes methionine. A substitution of valine for methionine 239 is a representative substitution, but other amino acids can also be substituted. In addition, hinge region variants of GP Ib a polypeptides suitable for use in a fusion polypeptide of the invention have mutations at residue both positions 233 and 239. (see e.g., Dong et al., JBC 275:36 27663-27670 (2000)) Thus, the invention includes fusion proteins that have a substitution at position 239, e.g., an M239V substitution of a variant GP Ib a polypeptide. Also within the invention is a fusion protein having a substitution at position 233, e.g., G233V, and a fusion protein that includes a variant GP Ib a polypeptide with positions at both 233 and 239, e .g, a G233V and M239V substitution..
In some embodiments, the first polypeptide includes a full-length GP Ib a polypeptide. Alternatively, the first polypeptide comprise less than full-length GP Ib a polypeptide. For example the first polypeptide less than 600 amino acids in length, e.g., less than or equal to 500, 250, 150, 100,50, or 25 amino acids in length.
In some embodiments, the second polypeptide is soluble. In some embodiments, the second polypeptide enhances the half-life, (e.g., the serum half-life) of the linked polypeptide. In some embodiments, the second polypeptide includes a sequence that facilitates association of the fusion polypeptide with a second GP Ib a polypeptide. In some embodiments, the second polypeptide includes at least a region of an immunoglobulin polypeptide. Immunoglobulin fusion polypeptide are known in the art and are described in e.g., US Patent Nos. 5,516,964; 5,225,538; 5,428,130;5,514,582; 5,714,147;and 5,455,165.
In some embodiments, the second polypeptide comprises a full-length immunoglobulin polypeptide. Alternatively, the second polypeptide comprise less than full-length immunoglobulin polypeptide, e.g., a heavy chain, light chain, Fab, Fab2, Fv, or Fc. For example, in some embodiments the second polypeptide includes the heavy chain of an immunoglobulin polypeptide. In further embodiments, the second polypeptide includes the Fc region of an immunoglobulin polypeptide.
In another aspect of the invention, the second polypeptide has less effector function that the effector function of a Fc region of a wild-type immunoglobulin heavy chain. Fc effector function includes for example, Fc receptor binding, complement fixation and T cell depleting activity (see; for example, US Patent No. 6,136,310). Methods of assaying T cell depleting activity, Fc effector function, and antibody stability are known in the art. In one embodiment the second polypeptide has low or no affinity for the Fc receptor. In an alternative embodiment, the second polypeptide has low or no affinity for complement protein Clq.
A representative second polypeptide sequence includes the amino acid sequence of SEQ ID NO: 10. This sequence includes a Fc region. Underlined amino acids are those that differ from the amino acid found in the corresponding position of the wild-type immunoglobulin sequence:
HTCPPCPAPEALGAPSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPVPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK SLSLSPGK (SEQ ID N0:10)
The GPIba polypeptide variants can include, in addition to the designated substituted amino acid substitution, an alternative amino acid that fulfills the same function as the designated acid, hi some embodiments, the alternative amino acid is related to the designated amino acid as a conservative amino acid substitution of the indicated amino acid. A "conservative amino acid substitution" is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine. glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine,
tryptophan, histidine).
•' \ Thus, in some embodiments, rather than replacing a tyrosine with a phenylalanine at position
276, 278, or 279 (Y276F, Y278F, or Y279F), the tyrosine residue can be replaced with tryptophan or histidine. Similarly, for the C65S variant, the cysteine may alternatively be replaced with glycine, asparagine. glutamine, threonine, or tyrosine. For the L237V substitution, the lysine may can
alternatively be replaced with alanine, leucine, isoleucine, proline, phenylalanine, methionine, or tryptophan.
The invention also includes a polypeptide whose sequence that are 80%, 85%, 90%, 95%, 98%, or 99% homologous to the sequence disclosed in SEQ ID NO:1 or SEQ ID NO:2, provided that it includes one or more of the amino acid substations C65S, K237V,Y276F Y278F, Y279F, K237V. Derivatives or analogs of the nucleic acids or proteins of the invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins of the invention, in various embodiments, by at least about 70%, 80%, 85%, 90%, 95%, 98%, or even 99% identity (e.g., an identity of 80-99%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the aforementioned proteins under stringent, moderately stringent, or low stringent conditions. An exemplary program is the Gap program (Wisconsin Sequence Analysis Package, Version 8 for UNIX, Genetics Computer Group, University Research Park, Madison, WI) using the default settings, which uses the algorithm of Smith and Waterman.
Another aspect of the invention pertains to vectors (including expression vectors) containing a nucleic acid encoding glycoprotein Iba fusion polypeptides, or derivatives, fragments, analogs or homologs thereof. Recombinant expression vectors of the invention can be designed for expression of glycoprotein Iba fusion polypeptides in prokaryotic or eukaryotic cells. ,
In another embodiment, the glycoprotein Iba fusion polypeptide expression vector is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerevisiae are known in the art.
Alternatively, glycoprotein Iba fusion polypeptide can be expressed in insect cells using methods known in the art, e.g., with baculovims expression vectors.
In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector.
In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific
regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art.
The invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an KNA molecule that is antisense to a gtycoprotein Iba fusion polypeptide mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced.
A host cell can be any prokaryotic or eukaryotic cell. For example, glycoprotein Iba fusion polypeptides can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as human, Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.
Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques.
Mammalian host cell, such as a Chinese hamster ovary cells (CHO) or COS cells can be transfected with expression vectors to enable, via posttranslational modification, the generation of the sialyl Lewis x epitope on the N-linked and 0-Iinked glycans of glycoprotein Iba fusion polypeptides. In the case of CHO cells this requires the co-expression of an a-1,3/1,4 fucosyltranseferase (Kukowska-Latallo et al., Genes Dev. 4:1288-303,1990 ) and Core2 beta-l,6-N-acetylglucbsaminyltransferase enzymes. (Kumar et al., Blood 88:3872-79,1996). The presence of the sialyl Lewis x epitopes on the N-linked and 0-linked glycans of glycoprotein Iba fusion polypeptides will enhance the binding to selectins.
For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA
into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding glycoprotein Iba fusion polypeptides or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).
A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) glycoprotein Iba fusion polypeptides. Accordingly, the invention further provides methods for producing glycoprotein Iba fusion polypeptides using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding glycoprotein Iba fusion polypeptides has been introduced) in a suitable medium such that glycoprotein Iba fusion polypeptides is produced. In another embodiment, the method further comprises isolating glycoprotein Iba fusion polypeptide from the medium or the host cell.
The fusion polypeptides may be isolated and purified in accordance with conventional conditions, such as extraction, precipitation, chromatography, affinity chromatography, electrophoresis or the like.
Chemical synthesis of polypeptides facilitates the incorporation of modified or unnatural amino acids, including D-amino acids and other small organic molecules. Replacement of one or more L-amino acids in a peptide with the corresponding D-amino acid isoforms can be used to increase the resistance of peptides to enzymatic hydrolysis, and to enhance one or more properties of biologically active peptides, i.e., receptor binding, functional potency or duration of action.
Introduction of covalent cross-links into a peptide sequence can conformationally and topographically constrain the polypeptide backbone. This strategy can be used to develop peptide analogs of the fusion polypeptides with increased potency, selectivity and stability. Because the conformational entropy of a cyclic peptide is lower than its linear counterpart, adoption of a specific conformation may occur with a smaller decrease in entropy for a cyclic analog man for an acyclic
analog, thereby making the free energy for binding more favorable. Macrocyclization is often
accomplished by forming an amide bond between the peptide N- and C-termini, between a side chain and the N- or C-termimis [e.g., with K3Fe(CN)e at pH 8.5], or between two amino acid side chains. Bisulfide bridges are also introduced into linear sequences to reduce their flexibility. Furthermore, the replacement of cysteine residues with penicillamine (Pen, 3-mercapto-(D) valine) has been used to increase the selectivity of some opioid-receptor, interactions.
Pharmaceutical Compositions Including Glycoprotein Iba Fusion Polypeptides or Nucleic Acids Encoding Same
The glycoprotein Iba fusion proteins, or nucleic acid molecules encoding these fusion proteins, (also referred to herein as "Therapeutics" or "active compounds") of the invention, and derivatives, fragments, analogs and homologs-thereof, can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protein, or antibody and a pharmaceutically acceptable carrier. As used herein, "pharmaceutically acceptable carrier" is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.
The active agents disclosed herein can also be formulated as liposomes. Liposomes are prepared by methods known in the art. Liposomes with enhanced circulation time are disclosed in U.S. Patent No. 5,013,556.
Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter.
A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, isotonic agents can be included in the composition, for example, sugars, polyalcdhols such as manitol and sorbitol; and sodium chloride\Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
Sterile injectable solutions can be prepared by incorporating the active compound (e.g., a
glycoprotein Ibex fusion protein) in the required amount in an appropriate solvent with one or a
combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.
Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.
In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art.
In some embodiments, oral or parenteral compositions are formulated in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.
The nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration or by stereotactic injection. The pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells that produce the gene delivery system.
Sustained-release preparations can be prepared, if desired. Suitable examples of sustained-release p/eparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides , copolymers of L-glutamic acid and y ethyl-L-glutamate, non-degradable ethylene-vinj'l acetate, degradable lactic acid-glycolic acid copolymers
such as the LUPRON DEPOT ™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(-)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.
The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.
METHODS OF INHIBITING ADHERENCE OF IN A BIOLOGICAL SYSTEM
Included in the invention is a method of inhibiting adherence of a blood cell to a biological tissue in a biological system. The method includes adding to a biological system a fusion polypeptide of the invention in an amount sufficient to inhibit adherence of a blood cell to the biological tissue.
The blood cell can be for example, a leukocyte, platelet or red blood cell. The leukocyte can be any leukocyte that is capable of adhering to a biological tissue. In various aspects the leukocyte is a granulocyte, (i.e., neutrophil, basophil or eosinohil), monocyte (i.e., macrophage) or lymphocyte (e.g., T-lymphocyte, B-lymphocyte, tumor infiltrating lymphocytes or natural killer cell). In some embodiments, the leukocytes express a p2 intergin, e.g. Mac-1. Alternately, the leuckocyte expresses a selectin ligand.
Also included in the inventions are methods of inhibiting adherence of a protein to a biological tissue in a biological system. The method includes adding to a biological system a fusion polypeptide of the invention in an amount sufficient to inhibit adherence of the protein to the biological tissue.
The protein can be membrane associated (e.g., covalently, non- covalently, or ionic). Alternatively, the protein can be in a soluble form (i.e., in solution). The protein is von Willebrand Factor, thrombin, P-selectin of glycoprotein Iba.
As used herein a biological system is meant to include any system that comprises biological components, e.g., cells, proteins, carbohydrates, lipids or nucleic acids. The biological system can be an in vivo, ex vivo or in vitro system.
"Adherence" is meant to include any biological interaction of a leukocyte, e.g., rolling, firm attachments or specific interaction.
Inhibition of adherence of a blood cell or protein to a biological tissue can be measured using methods known in the art. For example, assays for detecting binding of glycoprotein Ibcc to a biological tissue are described in Simon et al., J. Exp. Med. 192:193-204,2000, and references cited therein, hi various embodiments, binding of a GP Ib a fusion protein inhibits binding of a blood cell or protein to a biological tissue by at least 30%, 50%, 75%, 90%, 95%, 99% or 99.9%.
Adherence can also be assessed in condition of greater or less than physiological flow conditions, including static conditions and serial application of static and shear conditions. Adherence can be determined for example colormetrically, fluorometrically, by flow cytometry or using a parallel plate flow chamber assay.
Also included in the invention are methods of treating platelet activation associated disorders in a subject by administering to a subject a biologically-active therapeutic compound (hereinafter "Therapeutic"). Alternatively, the subject is also administered one or more of the following: a statin;acetylsalicylic acid (aspirin);heparin (including unfractionated or low-molecular weight heparins); glycoprotein Ilb/IHa antagonists; clopidogrel; P-selectin antagonists; thrombin inhibitors; and thrombolytic enzymes.
The subject can be e.g., any mammal, e.g., a human, a primate, mouse, rat, dog, cat, cow, horse, pig.
The therapeutics include, e.g.: (i) any one or more of the glycoprotein Iba polypeptideand derivative, fragments, analogs and homologs thereof; (ii) antibodies directed against the glycoprotein Iba polypeptides described in (i)and (iii) nucleic acids encoding a glycoprotein Iba polypeptide, and derivatives, fragments, analogs and homologs thereof as described in (i) above.
Essentially any disorder that is etiologically linked to platelet activation is considered amenable to prevention or to treatment. The disorder can be, e.g., vascular inflammation;
atherosclerosis; restenosis (e.g., angioplasty-ielated restenosis); and/or a condition associated with
thrombotic disease, e.g., angina, (including stable angina and unstable angina) acute myocardial
infarction, stroke, venous thrombosis or arterial thrombosis.
The invention will be further illustrated in the following non-limiting examples.
Example 1. GPIb-Ig tyrosine sulfation plays an important role in thrombin binding but is less important for v\VF binding
The role of the acidic carboxyl terminal region of GPIba in binding to vWF and thrombin was examined by tyrosine residues at positions 276,278, and/or 279 of three types of GPIbcc-IgGiFc fusion proteins: those with a wild-type human GPIba sequence; a fusion protein with the M239V (IV) substitution, and a fusion protein with a double G233V M239V (2V) substitution. The proteins were produced in Chinese Hamster Ovary (CHO) cells, then isolated by Protein A affinity chromatography and anion exchange chromatography. Dimerized forms of the fusion proteins in which the sulfation state varied from 0 to 6 were isolated.
Binding of the isoforms to the vWF Al domain (Al), to intact vWF, and to a-thrombin was examined using surface plasmon resonance (BiaCore).
The IV and 2V polypeptides bound with significantly higher affinity to the Al domain as compared to the WT polypeptides. The IV and 2V polypeptides also showed significantly enhanced affinity for intact vWF relative to the affinity of the fusion protein with the wild-type GPIba sequence for vWF The Kd for the 2V variant ranged from 4 run to 12 nm, and the Kd for the 1V variant ranged from 119 nm to 284 nM for fully sulfated to non-sulfated isoforms. Binding of wild-type GPIba to vWF was not detected under the same conditions, which indicates a Kd > 1 mM. Varying the sulfation state in WT, IV, and 2V did not correlate with a significant change in binding to Al domain or intact vWF. Finally, the GPIba -Ig-vWF interaction exhibited slow-on/slow-off kinetics typical of a hydrophobic interaction (Ka and Kd ~ 105M~VJ and ~10"3 s"1, respectively).
For GP Iba-Ig239V and GP Ib-Ig2V molecules, the binding affinity of the fully sulfated isoform to thrombin was ~ 80-fold higher than that of the unsulfated isoform (Kp of 0.5 |iM and 40 |j,M, respectively). For vWF binding, the fully sulfated molecules were only 3-4 fold more active than the unsulfated forms of both mutants (KD = 3.4 - 15 nM for 2V 6-0 sulfated, 113 - 521 nM for IV 6-0 sulfated). The relationship between sulfation state and binding to von Willebrand Factor and binding to thrombin was also examined.
Rat tail bleeding method: Adult male Sprague Dawley rats (Taconic), weighing 250-300gm, were used. The animals were equipped with a jugular vein catheter by the vendor before arriving. The animals were housed in individual cages at room temperature under a light period of 12hr (6:am
-6:pm) at our institutional animal facility and were provided standard laboratory rodent chow and water ad libitum. The animals were acclimated to their new environment at least three days before the use.
GPIb-Ig sample administration and rat Tail vein bleeding procedures: On the day of the
experiment, an extension tubing (20 cm of PE 50 tubing) with a 3-way stopcock and a 1-cc syringe filled with sterile isotonic 0.9% saline was attached to the indwelling jugular vein catheter. Stock GPIb-Ig test sample was diluted with isotonic 0.9% saline and was administered at indicated doses in a volume of 0.1ml per 100 gm body weight via another arm of the 3-way stopcock. The catheter was flushed with 0.2 ml of saline. Ten minutes after the injection, the rats were removed from their home cage and were gently put into a restrainer. The distal 1-2 mm segment of the tail was transected using a razor blade and the tail was quickly immersed into a SOOml-beaker pre-filled with 0.9% isotonic saline (temperature 37°C). Bleeding time was defined as the period of tune from the start of the tail bleeding to completely cease of bleeding (no re-bleeding within 30 second once the bleeding has stopped). At the end of the experiment, the rats were euthanized by inhalation of COa.
In the rat tail bleeding assay, 10 minutes following an i.v. dose of 200ug/kg, bleeding time of four minutes was detected in GPIbcc variants with a sulfation state 0, 1, or 2. Bleeding time increased as the sulfation state increased to 6, where bleeding time was 10 minutes.
These data demonstrate that sulfation plays a role in thrombin binding, but a much lesser role in vWF binding. However, the sulfation state significantly affects binding to a- thrombin. The stoichiometry of GPIba-Ig binding with thrombin was greater than 2 a-thrbmbin per GPIba-Ig. The a-thrombin-GPIba interaction is much more sensitive to the GPIba-Ig sulfation state compared with the hyrdophobicity of the Cys208-Cys249 loop of GPIba, which binds vWF. These results indicate that the GPIba contains two functionally distinguishable subdomains: one for vWF binding and one for thrombin binding.
Example 2. Cys 65 in GPIba is involved in aggregation
The crystal structure reveals that Cys65 of GPIba is buried in the LRR region. The very low labeling ratio (about 5%) with thiol-reactive probes under native conditions demonstrated the inaccessibility of this Cys residue. Ellman's assay and preliminary native peptide mapping showed
that there was no modification on Cys65. However, even a very small amount of exposed thiol could form intermolecular disulfide bonds and caused aggregation. The role of this residue in aggregation was examined.
When GP Ibcc sample was stressed at 40 °C for 80 hrs, about 25% of total protein formed aggregates. The aggregates were reducible but mostly SDS stable. Analytical ultracentrifugation indicated that the aggregates ranged from dimer to octamer. Non-reduced, alkylated Achro-K peptide map of the aggregates showed that the free Cys-containing peptide (K4 peptide) disappeared in the map, which might form a large peptide with another K4 and other Cys containing peptides. To confirm the role of the free Cys in aggregation, the GP Iba sample was heat-stressed in 1 M GnHCl which resulted in total covalent aggregation. In the presence of 1M GnHCl, the protein structure is likely to be loosened, thereby exposing the buried Cys65, and accelerating the aggregation. These data suggest that under these conditions the free Cys residue can be involved in aggregation.
Example 3. GPIboc fusion proteins interact with vWF polypeptide
Evidence for a direct interaction between a GPIba fusion protein variants and vWF polypeptide was examined.
The GPIba fusion protein variants tested included IV, 2V, 3V, 3V/C65S, 2V/FFF, and a variant named "clipped 2V". Control reactions included a 290 amino acid GPIba protein, a vWF polypeptide alone or an irrelevant control polypeptide (47.mFc, a PSGL-1 fusion protein).
A fusion polypeptide or control polypeptide was mixed with Protein A Sepharose beads, which bound to the immunoglobulin moieties of the fusion protein. Protein bound to the Protein A Sepharose beads were eluted and electrophoresed through a 3-8% Tris-Acetate gel. The gel was then immunoblotted with a polyclonal antibody to vWF, and the antibody detected. Gels were run under both reducing and non-reducing conditions. The procedure was performed twice.
The results of binding to the vWF Al fragment or to intact vWF fragment are shown below. vWF showed the strongest binding to the GPIBa variants 3V and 3V/C65S when assayed under both reducing and non-reducing conditions. Strong binding was also observed with the 2V variant, while comparatively less binding was detected with the IV variant and the 2V/FFF variant. The GPIba wild-type polypeptide showed weak binding to vWF in these experiments.
(Table Removed)
Example 5: In vivo inhibition of repetitive coronary artery thrombosis
The ability of a fusion Iba protein-immunoglobulin protein to inhibit coronary artery thrombosis in vivo is determined using the procedure described by Folts at al., Circulation 54:365-70, 1976 is examined. The fusion protein includes a GPIboc sequence with the substitutions G233V K237V and M239V relative to the amino acid sequence of SEQ ID NO:L
Mongrel dogs, weighing 20-25kg, are anesthetized with sodium pentobarbital (30mg/kg i.v.), then intubated and ventilated with room air using a respirator. Venous and arterial catheters are placed. The heart is approached by left thoracotomy through the fifth intercostal space. The pericardium is opened and sutured to the wound edges to provide a cradle without displacing the heart. About 2cm of the left circumflex coronary artery (LCX) is isolated. Mean and dynamic LCX flow are continuously monitored using a perivascular ultrasonic flow probe placed proximally on the artery. After a stabilization period, the endothelium of the LCX is injured by squeezing with a hemostat. A plastic constrictor is placed distal and overlying the area of injured endothelium to provide approximately 70-80% vessel stenosis. When blood flow decreases to zero, the blood flow is restored by shaking the constrictor to dislodge aggregated platelets. This decrease and restoration of blood flow are termed CFRs. At least five consecutive CFRs are recorded prior to administering the test drug.
Increasing amounts of 3V results in higher blood flow. These results demonstrate that the fusion glycoproteins inhibit thrombosis in the animal model.
Example 6. In vivo treatment of a subject with of unstable angina HJA) or non-ST-clevated myocardial infarction fNSTEMI)
A GPIBot-Ig variant according to the invention is administered as a fusion protein by a single intravenous bolus injection (10 mg) to a patient with unstable angina or non-ST-elevated myocardial
infarction (NSTEMI). Treatment with the variant ameliorates the UA or NSTEMI. The ristocetin induced platelet aggregation assay (RPA) is used to monitor GPIb-Ig activity.
Example 7. Comparison of bleeding times using clopidogrel and GPIba 2V or GPIba 2V /FFF variants
The effect on bleeding time was examined by comparing bleeding times in rats treated with clopidogrel and GPIba 2V or two different doses of GPIba 2V/FFF, which lack thrombin binding sites.
The GPIba variant was administered intravenously two hours after administration of clopidogrel (4.3 mg/kg, po). GPIba variants tested included GPIba 2V/290/FFF GPIba 2V/290 GPIba 2V/290 GPIba 2V/290, GPIba 2V/290/FFF (100 meg/kg), and GPIba 2V/290 (50 meg/kg). RBT was measured 15 minutes after administration of the GPIa variant. Six or seven animals were tested for each treatment.
Bleeding time increased from 8.2 minutes (N = 7) in rats treated with clopidogrel alone to 24 minutes in rats treated with clopidogrel and 50 meg/kg of GPIba 2V/290 (N = 6). Bleeding time increased to 13.9 minutes in rats treated with 50 meg/kg of GPIba 2V/290/FFF (N = 6), and to 19 minutes in rats treated with 100 meg/kg of GPIba 2V/290/FFF (N = 7). Thus, a shorter bleeding time was observed in animals given twice the dose of the GPIba 2V/290/FFF as compared to animals given the GPIba 2V/290 variant.
Example 8. Comparison of antithrombotic efficacy of sulfated and non-sulfated forms of recombinant soluble GPIba chimeras in a canine model of coronary artery thrombosis
The ligand binding capacity and anti-thrombotic efficacy of a1 non-sulfated recombinant human GPIba chimera (GPIb-290/2V/FFF-Ig) was compared to that ofa sulfated recombinant human GPIba chimera (GPIb-290/2V-Ig).
Soluble recombinant GPIba Chimeras used included GPIb-290/2V-Ig, which consists of the N-terminal 290 amino acids of GPIba with gain-of-function valine substitutions at positions 233 and
239, fused to a human IgGl Fc domain. GPIba-290/2V/FFF-Ig was generated by further substituting three tyrosine residues (Tyr-276,278,279) with phenylalanines to eliminate sulfation.
Cyclic flow reductions (CFRs) were induced by crush injury of the left circumflex coronary artery in anesthetized male mongrel dogs. Coronary blood flow was continuously monitored using a perivascular ultrasonic flow probe. The template bleeding time was measured at the surface of the inner upper lip using an automated cutting device. The bleeding time prolongation caused by sulfated and non-sulfated GPIba chimeras was assessed by using rat tail bleeding model. Platelet function in whole blood before and at various time points after treatment in Folts' model was measured with a Platelet Function Analyzer-100 (PFA-100).
The binding abilities of GPIba-290/2V-Ig and GPIbot-290-2V/FFF-Ig to vWF and a-thrombin were evaluated in vitro using a Biacore assay. The results are presented below:

(Table Removed)
The effect of wild-type, or GPIb chimeras on ristocetin-induced human platelet aggregation is shown in FIGS. 1A-1D. Shown are wild-type GPIba ("Normal"). GPIb-Ig WT , GPIba-290/2V-Ig, and GPIba-290/2V/FFF-Ig.
The dose response of GPIb-290/2V-Ig ("2V") and GPlb-290/FFF-Ig ('TFF") in a canine Folts' model of coronary thrombosis is shown below. A score of 4 was given if CFRs were completely eliminated, and a score of 3 was given if the CFRs were not completely abolished, but the coronary was able to spontaneously open.
(Table Removed)
Rat tail bleeding time prolongation caused by GPIb-290/2V-Ig and GPIb-290/2V/FFF-Ig was also examined:

(Table Removed)
FIG. 2 is a graph showing the antithrombotic efficacy of GPIboc chimeras in a canine Folts' model of coronary thrombosis (y-axis: LCX blood)
FIG. 3 is a graph showing inhibition of platelet function by GPIb/290/2V-Ig and GPIb/290/2V/FFF-Ig in a canine model of coronary thrombosis assessed by PFA-100.
These results demonstrate that conversion of the six sulfated tyrosines to phenylalanines decreases vWF Al domain binding by ~ 3- fold in these studies and almost completely abrogated thrombin binding. GPIb/290/2V/FFF-Ig demonstrated a 50% decrease in potency as compared with GPIb-290/2V-Ig in cyclic flow reduction, bleeding time prolongation and ADP closure times assessed using a PFA-100. The prevention of arterial thrombus formation by GPIba chimeras at these doses occurs via inhibition of the vWF Al domain, and this activity is independent of a thrombin binding.
OTHER EMBODIMENTS
While the invention has been described hi conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

WE CLAIM:
1. An isolated polypeptide comprising SEQ ID N0:2, provided said polypeptide comprises substitutions K237V and C65S;
wherein said polypeptide binds to von Willebrand factor with an affinity that is at least 10-fold higher than a GP1bα polypeptide comprising SEQ ID NO: 1; and wherein said polypeptide has at least one activity selected from the group consisting of:
1) lower affinity binding to alpha thrombin relative to binding to alpha thrombin of a protein sequence with the amino acid sequence of SEQ ID NO: 2;
2) lower aggregation relative to aggregation of a protein sequence with the amino acid sequence of SEQ ID NO: 2; and
3) increased resistance to proteolysis relative to a protein sequence with the amino acid sequence of SEQ ID NO: 2.

2. The polypeptide of claim 1, wherein said polypeptide is provided as a fusion protein.
The fusion protein of claim 1, comprising a region of an immunoglobulin.

Documents

Application Documents

# Name Date
1 5908-DELNP-2005_EXAMREPORT.pdf 2016-06-30
1 Form-3 (16-10-2009).tif 2009-10-16
2 5908-delnp-2005-abstract.pdf 2011-08-21
2 5908-DELNP-2005-Petiton-138 (16-10-2009).pdf 2009-10-16
3 5908-DELNP-2005-Petiton-137 (16-10-2009).pdf 2009-10-16
3 5908-delnp-2005-assignments.pdf 2011-08-21
4 5908-DELNP-2005-Form-2 (16-10-2009).pdf 2009-10-16
4 5908-delnp-2005-claims.pdf 2011-08-21
5 5908-DELNP-2005-Form-1 (16-10-2009).pdf 2009-10-16
5 5908-delnp-2005-correspondence-others.pdf 2011-08-21
6 5908-DELNP-2005-Drawings (16-10-2009).pdf 2009-10-16
6 5908-delnp-2005-description (complete).pdf 2011-08-21
7 5908-delnp-2005-drawings.pdf 2011-08-21
7 5908-DELNP-2005-Description (Complete) (16-10-2009).pdf 2009-10-16
8 5908-delnp-2005-form-1.pdf 2011-08-21
8 5908-DELNP-2005-Correspondence-Others (16-10-2009).pdf 2009-10-16
9 5908-DELNP-2005-Claims (16-10-2009).pdf 2009-10-16
9 5908-delnp-2005-form-18.pdf 2011-08-21
10 5908-DELNP-2005-Abstract (16-10-2009).pdf 2009-10-16
10 5908-delnp-2005-form-2.pdf 2011-08-21
11 5908-DELNP-2005-Correspondence-Others (18-01-2010).pdf 2010-01-18
11 5908-delnp-2005-form-3.pdf 2011-08-21
12 5908-DELNP-2005-Correspondence-Others-(05-05-2010).pdf 2010-05-05
12 5908-delnp-2005-form-5.pdf 2011-08-21
13 5908-delnp-2005-gpa.pdf 2011-08-21
13 5908-delnp-2005-pct-311.pdf 2011-08-21
14 5908-delnp-2005-pct-210.pdf 2011-08-21
14 5908-delnp-2005-pct-308.pdf 2011-08-21
15 5908-DELNP-2005-PCT-220.pdf 2011-08-21
15 5908-delnp-2005-pct-306.pdf 2011-08-21
16 5908-delnp-2005-pct-237.pdf 2011-08-21
16 5908-delnp-2005-pct-304.pdf 2011-08-21
17 5908-delnp-2005-pct-304.pdf 2011-08-21
17 5908-delnp-2005-pct-237.pdf 2011-08-21
18 5908-DELNP-2005-PCT-220.pdf 2011-08-21
18 5908-delnp-2005-pct-306.pdf 2011-08-21
19 5908-delnp-2005-pct-210.pdf 2011-08-21
19 5908-delnp-2005-pct-308.pdf 2011-08-21
20 5908-delnp-2005-gpa.pdf 2011-08-21
20 5908-delnp-2005-pct-311.pdf 2011-08-21
21 5908-DELNP-2005-Correspondence-Others-(05-05-2010).pdf 2010-05-05
21 5908-delnp-2005-form-5.pdf 2011-08-21
22 5908-DELNP-2005-Correspondence-Others (18-01-2010).pdf 2010-01-18
22 5908-delnp-2005-form-3.pdf 2011-08-21
23 5908-DELNP-2005-Abstract (16-10-2009).pdf 2009-10-16
23 5908-delnp-2005-form-2.pdf 2011-08-21
24 5908-delnp-2005-form-18.pdf 2011-08-21
24 5908-DELNP-2005-Claims (16-10-2009).pdf 2009-10-16
25 5908-delnp-2005-form-1.pdf 2011-08-21
25 5908-DELNP-2005-Correspondence-Others (16-10-2009).pdf 2009-10-16
26 5908-delnp-2005-drawings.pdf 2011-08-21
26 5908-DELNP-2005-Description (Complete) (16-10-2009).pdf 2009-10-16
27 5908-DELNP-2005-Drawings (16-10-2009).pdf 2009-10-16
27 5908-delnp-2005-description (complete).pdf 2011-08-21
28 5908-DELNP-2005-Form-1 (16-10-2009).pdf 2009-10-16
28 5908-delnp-2005-correspondence-others.pdf 2011-08-21
29 5908-DELNP-2005-Form-2 (16-10-2009).pdf 2009-10-16
29 5908-delnp-2005-claims.pdf 2011-08-21
30 5908-DELNP-2005-Petiton-137 (16-10-2009).pdf 2009-10-16
30 5908-delnp-2005-assignments.pdf 2011-08-21
31 5908-delnp-2005-abstract.pdf 2011-08-21
31 5908-DELNP-2005-Petiton-138 (16-10-2009).pdf 2009-10-16
32 5908-DELNP-2005_EXAMREPORT.pdf 2016-06-30