Sign In to Follow Application
View All Documents & Correspondence

Porphyromonas Gingivalis Polypeptides

Abstract: Abstract Provided herein are compositions and methods for eliciting an immune response against Porphyromonas gingivalis. The compositions and methods relate to P. gingivalis polypeptides and fragments and variants thereof and the corresponding polynucleotides which are useful in the diagnosis  prevention and therapy of P. gingivalis infections (e.g. periodontitis). Antibodies against the polypeptides and compositions and methods including these antibodies are also disclosed. The disclosure also describes methods for the detection  prevention and treatment of P. gingivalis infection (e.g. periodontitis).

Get Free WhatsApp Updates!
Notices, Deadlines & Correspondence

Patent Information

Application #
Filing Date
01 February 2012
Publication Number
44/2012
Publication Type
INA
Invention Field
BIOTECHNOLOGY
Status
Email
patent@depenning.com
Parent Application

Applicants

Sanofi Pasteur Limited
1755 Steeles Avenue West  Toronto  Ontario M2R 3T4  Canada

Inventors

1. MCCLUSKEY  Jacqueline
1755 Steeles Ave West  Toronto  Ontario M2R 3T4  Canada
2. QUEMENUTER  Laurence
80 avenue Marcel Merieux  F-69280 March L"Etoile  France
3. YETHON  Jeremy
1755 Steeles Ave West  Toronto  Ontario M2R 3T4  Canada
4. LEACH  Michael
1755 Steeles Ave West  Toronto  Ontario M2R 3T4  Canada

Specification

PQRPHYRQMQNAS GINGIVALIS POLYPEPTIDES

CROSS-REFERENCE TO RELATED APPLICATION

This application claims the benefit of U.S. Provisional Application No. 61/230 717  filed on August 2  2009  which is hereby incorporated herein by reference in its entirety.

FIELD OF THE INVENTION

The present invention relates to the field of immunology and in particular to P. gingivalis antigens and their use in immunization and therapy.

BACKGROUND

Periodontitis (or periodontal disease) is an inflammatory disease of the supporting tissues of the teeth. Disease progression is characterized by formation of a periodontal pocket (harbouring bacterial plaque)  progressive destruction of supporting connective tissue and loss of alveolar bone  leading to progressive loosening and eventual loss of teeth. Periodontal disease is associated with specific bacteria in subgingival dental plaque. Porphyromonas gingivalis is considered one of the most etiologically important pathogens associated with periodontitis and its progression. This black-pigmented  asaccharolytic  Gram-negative anaerobe  relies on the metabolism of specific amino acids for energy. P. gingivalis has an absolute requirement for iron  preferentially in the form of heme or its Fe(IIl) oxidation product hemin and when grown under conditions of excess hemin is highly virulent in experimental animals.

A number of virulence factors have been implicated in the pathogenicity of P. gingivalis including the capsule  adhesins  cytotoxins and extracellular hydrolytic enzymes. A major virulence factor and vaccine candidate of the P. gingivals are the extracellular cysteine proteinases or gingipains (Rgp?  RgpB and Kgp). These have been extensively studied (1-8). The gingipain complex alone has been shown to protect against periodontal bone loss in prophylactic animal models and antibodies specific to this complex have demonstrated protective efficacy in human studies (9  10). Despite this  virulence and the disease-causing capacity of P. gingivalis may likely be multifactoral  involving a number of determinants (1 1).

The genome of P. gingivalis strains W83 and ATCC 33277 have each been sequenced (12 13)  but these references do not provide any teaching on which P. gingivalis antigens are immunogenic and otherwise useful.

Consequently  there remains a need for effective treatments of P. gingivalis infections.

SUMMARY OF THE INVENTION

The present invention provides compositions and methods for eliciting an immune response against P. gingivalis. Also provided are methods for the prevention or treatment of a P. gingivalis infection (e.g.  periodontitis). In one example  the composition comprises at least one polypeptide selected from the group consisting of PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG 1326  PG1798  PG0186 and PG0616. Antibodies that bind specifically to these polypeptides and compositions comprising  and methods of using  such antibodies are also provided.

Compositions  such as pharmaceutical compositions {e.g.  vaccine compositions) including one or more polypeptides are provided. Optionally  the compositions can include an adjuvant.

The invention provides several advantages. For example  administration of the compositions of the present invention to a subject elicits an immune response against infections by P. gingivalis.

Other features and advantages of the invention will be apparent from the following Detailed Description  the Drawings and the Claims.

BRIEF DESCRIPTION OF THE FIGURES

The present invention will be further understood from the following description with reference to the drawings  in which:

Figure 1 Consisting of panels A and B  illustrates P. gingivalis specific IgG responses. Fig. Ia depicts the serum anti-protein IgG antibody responses of Example 3 and Fig. IB depicts the serum total IgG antibody responses of Example 3

Figure 2 Depicts accessibility of proteins on cell surface of P. gingivalis (W50 strain)  at stationary phase  as measured by a flow cytometry based assay. Each dot on Y-axis represents result obtained. Average of results represented by a horizontal dash (— ). Name of each protein identified on X-axis. Presence of proteins in outer membrance fractions of P. gingivalis was also assessed (as discussed in Example 4) and results provided on X-axis (e.g.  + indicates protein was detected in OM fraction; - indicates protein was absent from OM fraction; * indicates that the protein was detected in the OM in some experiments but not in others.

Figure 3 Depicts anti-/3. gingivalis protein IgG antibody responses. Groups of micewere immunized with P. gingivalis polypeptide in the presence of  or in the absence of  aluminum

hydroxide. P. gingivalis specifc IgG antibody titers were measured. Each bar represents the mean antibody titer and symbols correspond to a single mouse of each group.

Figure 4 Depicts serum bactericidal activity of serum samples obtained from mice immunized with proteins

Figure 5 Depicts opsonophagocytic study activity of specific anti-protein sera

Figure 6 Depicts accessibility of proteins on cell surface of three strains of P. gingivalis (W50 

W83  ?TCC33277) as measured by a flow cytometry based assay. Additionally  the accessibility of proteins on P. gingivalis W50 grown to different growth phases was also assessed. Each dot on the Y-axis represents the result obtained in an assay performed using protein specific antisera.

DETAILED DESCRIPTION OF THE INVENTION

The present invention provides P. gingivalis polypeptides and their corresponding encoding nucleic acids which elicit an immune response when administered to a subject. Provided for example  are polypeptides of PG0495  PG0654  PG1374  PG 1795  PG2172  PG0613  PG1326  PG1798  PGO 186 and PG0616  nucleic acid sequences that encode these polypeptides and antibodies that bind specifically to these polypeptides. Immunogenic compositions comprising at least one P. gingivalis polypeptide and methods for preventing  treating and reducing the risk of a P. gingivalis infection  and for eliciting or inducing an immune response in a subject using these compositions are also provided as are methods for making the compositions. The polypeptide and nucleic acid sequences of the present invention include  but are not limited to  the specific nucleic acid and amino acid sequences set forth in the Sequence Listing that forms part of the present specification. These polypeptides  compositions and methods are described further below.

Definitions

The term "antigen" as used herein refers to a substance that is capable of stimulating immune responses. The immune responses stimulated by antigens may be one or both of humoral or cellular  and generally are specific for the antigen. An antigen is capable of initiating and mediating the formation of a corresponding immune body (antibody) when introduced into a subject. An antigen may possess multiple antigenic determinants such that the exposure of the subject to an antigen may produce a plurality of corresponding antibodies with differing specificities. Antigens may include  but are not limited to proteins  peptides  polypeptides  nucleic acids and fragments  variants and combinations thereof.

The terms peptides  proteins and polypeptides are used interchangeably herein.

?n "isolated" polypeptide is one that has been removed from its natural environment. For instance  an isolated polypeptide is a polypeptide that has been removed from the cytoplasm or from the membrane of a cell  and many of the polypeptides  nucleic acids  and other cellular material of its natural environment are no longer present. ?n "isolatable" polypeptide is a polypeptide that could be isolated from a particular source. ? "purified" polypeptide is one that is at least 60% free  preferably at least 75% free  and most preferably at least 90% free from other components with which they are naturally associated. Polypeptides that are produced outside the organism in which they naturally occur  e.g. through chemical or recombinant means  are considered to be isolated and purified by definition  since they were never present in a natural environment.

The term "surface accessible protein" refers to all surface exposed proteins  including for example  inner and outer membrane proteins  proteins adhering to the cell wall and secreted proteins.

?s used herein  a "fragment" of a polypeptide preferably has at least about 40 residues  or 60 residues  and preferably at least about 100 residues in length. Fragments of P. gingivalis polypeptides can be generated by methods known to those skilled in the art.

The term "antibody" or "antibodies" refers to monoclonal and polyclonal antibodies and includes whole or fragmented antibodies in unpurified or partially purified form {i.e.  hybridoma supernatant  ascites  polyclonal antisera) or in purified form. In some embodiments  antigen-binding portions of antibodies include Fab  Fab""  F(ab"")2  Fd  Fv  dAb and complementary determining region (CDR) variants  single chain antibodies (scFv)  chimeric antibodies such as humanized antibodies  diabodies and polypeptides that contain at least a portion of an antibody that is sufficient to confer specific antigen binding to the polypeptide.

? "purified" antibody is one that is separated from at least about 50% of the proteins with which it is initially found {i.e.  as part of a hybridoma supernatant or ascites preparation).

?s used in the specification and the appended claims  the singular forms "a"  "an"  and "the" include plural referents unless the context clearly dictates otherwise. Thus  for example  reference to a fragment may include mixtures of fragments and reference to a pharmaceutical carrier or adjuvant may include mixtures of two or more such carriers or adjuvants.

?s used herein  a subject or a host is meant to be an individual. The subject can include domesticated animals  such as cats and dogs  livestock {e.g.  cattle  horses  pigs  sheep  and goats)  and laboratory animals {e.g.  mice  rabbits  rats  guinea pigs). In one aspect  the subject is a mammal such as a primate or a human.

Optional or optionally means that the subsequently described event or circumstance can or cannot occur  and that the description includes instances where the event or circumstance occurs and instances where it does not. For example  the phrase  "optionally the composition can comprise a combination" means that the composition may comprise a combination of different molecules or may not include a combination such that the description includes both the combination and the absence of the combination (i.e.  individual members of the combination).

Ranges may be expressed herein as from about one particular value  and/or to about another particular value. When such a range is expressed  another aspect includes from the one particular value and/or to the other particular value. Similarly  when values are expressed as approximations  by use of the antecedent about or approximately  it will be understood that the particular value forms another aspect. It will be further understood that the endpoints of each of the ranges are significant both in relation to the other endpoint  and independently of the other endpoint.

When the terms prevent  preventing  and prevention are used herein in connection with a given prophylactic treatment for a given condition (e.g.  preventing infection by P.gingivalis)  it is meant to convey that the treated subject either does not develop a clinically observable level of the condition at all  or develops it more slowly and/or to a lesser degree than he/she would have absent the treatment. These terms are not limited solely to a situation in which the subject experiences no aspect of the condition whatsoever. For example  a treatment will be said to have prevented the condition if it is given during exposure of a patient to a stimulus that would have been expected to produce a given manifestation of the condition  and results in the subject""s experiencing fewer and/or milder symptoms of the condition than otherwise expected. ? treatment can "prevent" infection by resulting in the subject""s displaying only mild overt symptoms of the infection; it does not imply that there must have been no penetration of any cell by the infecting microorganism.

Similarly  reduce  reducing  and reduction as used herein in connection with the risk of infection with a given treatment (e.g.  reducing the risk of a P.gingivalis infection) refers to a subject developing an infection more slowly or to a lesser degree as compared to a control or basal level of developing an infection in the absence of a treatment. ? reduction in the risk of infection may result in the subject displaying only mild overt symptoms of the infection or delayed symptoms of infection; it does not imply that there must have been no penetration of any cell by the infecting microorganism (i.e.  P. gingivalis).

When the terms treat and treating are used herein in connection with a given treatment for a given condition (e.g.  treating an infection  or a disease (symptomatic infection) caused by P.

gingivalis)  it is meant to convey that the treated subject displays either no clinically observable level of the condition or displays it to a lesser degree than he did before the treatment. ? treatment can "treat" an infection or disease by resulting in the subject displaying milder overt syptoms of the infection; it does not imply that there must have been a complete eradication of the infecting microorganism (i.e.  P. gingival is).

P. gingival is Polypeptides and Nucleic Acids

The present invention provides isolated polypeptides and nucleic acids derived from P.

gingivalis which are useful inter alia as components in immunogenic compositions  and/or as reagents for diagnosing P. gingivalis infections (e.g. as probes). Preferred embodiments of the present invention include one or more polypeptides of PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG 1326  PG1798  PG0186 and PG0616 and isolated nucleic acids encoding these polypeptides. Each of PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG1326  PG1798  PGO 186 and PG0616 were identified by mining the genome of the P. gingivalis W83 strain for candidates which were then isolated from the P. gingivalis W50 strain (?TCC 53978) using parameters and procedures described in more detail in Example 1.

Compositions of the present invention comprise at least one polypeptide of PG0495  PG0654  PG 1374  PG1795  PG2172  PG0613  PG1326  PG1798  PG0186 and PG0616. For each of PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG1326  PG 1798  PG0186 and PG0616  polypeptides suitable for use comprise the full length amino acid sequence (in the presence or absence of signal sequence)  and immunogenic fragments  variants(naturally occurring or otherwise  e.g.  synthetically derived)  and fusion proteins thereof.

PG0495 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG0495. PG0495 is also known as PGN_1476. The amino acid sequence of full length P0495 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q65689.1 and is provided in the Sequence Listing herein as SEQ ID NO.1. Preferred P0495 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity (e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO: 1. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO. l. Preferred fragments comprise an epitope from SEQ ID NO: 1. Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO: 1 (e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO: 1 while retaining at least one

epitope of SEQ ID NO: 1. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ lD NO: l .

PG0654 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG0654. PG0654 is also known as PGN_0693. The amino acid sequence of full length P0654 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q656833.1 and is also set out in the Sequence listing herein as SEQ ID NO.9. Preferred P0654 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity {e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO:9. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.9. Preferred fragments comprise an epitope from SEQ ID NO:9 Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO:9 {e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO:9 while retaining at least one epitope of SEQ ID NO:9. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ lD NO:9.

PG 1374 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG 1374. PG 1374 is also known as PGN_0852. The amino acid sequence of full length P1374 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q66438.1 and is also set out in the Sequence Listing herein as SEQ ID NO.7. Preferred P 1374 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity {e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO:7. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.7. Preferred fragments comprise an epitope from SEQ ID NO:7 Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO:7 {e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO:7 while retaining at least one epitope of SEQ ID NO:7. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ lD NO:7.

PG 1795 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG 1795. PG 1795 is also known as PGN_1770. The amino acid sequence of full length

P1795 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q66795.1 and is also set out in the Sequence Listing herein as SEQ ID NO.17. Preferred P1795 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity (e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO: 17. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.17. Preferred fragments comprise an epitope from SEQ ID NO: 17 Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO: 17 (e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO: 17 while retaining at least one epitope of SEQ ID NO: 17. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ ID NO: 17.

PG2172 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG2172. PG2172 is also known as PGN_0123. The amino acid sequence of full length P2172 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q67121.1 and is also set out in the Sequence Listing herein as SEQ ID NO.3. Preferred P2172 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity (e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO:3. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.3. Preferred fragments comprise an epitope from SEQ ID NO:3 Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO:3 (e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO:3 while retaining at least one epitope of SEQ ID NO:3. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ lD NO:3.

PG0613 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG0613. PG0613 is also known as PGN_0656. The amino acid sequence of full length P0613 in the P. gingivalis W83 genome is available via GenBank Accession No. ??Q65797.1 and is also set out in the Sequence Listing herein as SEQ ID NO. l 1. Preferred P0613 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity (e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO: 1 1. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO. l 1. Preferred fragments comprise an epitope from SEQ ID NO: 1 1 Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO: 1 1 {e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO: 1 1 while retaining at least one epitope of SEQ ID NO: 1 1. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ lD NO: l l .

PG 1326 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50  and ?TCC33277  and any other strain expressing PG1326. PG1326 is also known as PGN_1 1 15. The amino acid sequence of full length P1326 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q66396.1 and is also set out herein as SEQ ID NO.5. Preferred P1326 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity {e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO:5. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.5. Preferred fragments comprise an epitope from SEQ ID NO:5 Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO:5 {e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO:5 while retaining at least one epitope of SEQ ID NO:5. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ ID NO:5.

PG 1798 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG 1798. PG 1798 is also known as PGN_1767. The amino acid sequence of full length P1798 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q66797.1 and is set out in the Sequence Listing herein as SEQ ID NO.13. Preferred P 1798 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity {e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO: 13. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.13. Preferred fragments comprise an epitope from SEQ ID NO: 13. Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO: 13 {e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO: 13 while retaining at least one epitope of SEQ ID NO: 13. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ ID NO: 13.

PGO 186 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PGO 186. PGO 186 is also known as PGN_0294. The amino acid sequence of full length PO 186 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q65421.1 and is also set out in the Sequence Listing herein as SEQ ID NO.15. Preferred P0186 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity {e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO: 15. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.?. Preferred fragments comprise an epitope from SEQ ID NO: 15. Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO: 15 {e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO: 15 while retaining at least one epitope of SEQ ID NO: 15. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ ID NO: 15.

PG0616 polypeptides suitable for use in the compositions described herein may be isolated or derived from from the P. gingivalis strains W83  W50 and ?TCC33277  and any other strain expressing PG0616. PG0616 is also known as PGN_0659. The amino acid sequence of full length P0616 in the P. gingivalis W83 genome is accessible via GenBank Accession No. ??Q65800.1 and is also set out in the Sequence Listing herein as SEQ ID NO.19. Preferred P0616 polypeptides for use with the invention comprise an amino acid sequence having 50% or more identity {e.g.  60  65  70  75  80  85  90  91  92  93  94  95  96  97  98  99  99.5% or more) to SEQ ID NO: 19. Preferred polypeptides for use with the invention comprise a fragment of at least 8  9  10  12  13  16  18  20  25  30  35  40  50  60  70  80  90  100  150  200  250 or more consecutive amino acids of SEQ ID NO.19. Preferred fragments comprise an epitope from SEQ ID NO: 19 Other preferred fragments lack one or more acids from the N-terminus of SEQ ID NO: 19 {e.g.  1  2  3  4  5  6  7  8  9  10  15  20  25 or more) and/or one or more amino acids from the C-terminus of SEQ ID NO: 19 while retaining at least one epitope of SEQ ID NO: 19. Further preferred polypeptides lack the signal sequence from the N-terminus of SEQ ID NO: 19.

The invention includes polynucleotides that encode a polypeptide of the invention and polynucleotides which hybridize  under standard hybridization conditions  to a polynucleotide that encodes a polypeptide of the invention  and the complements of such polynucleotide sequence. ?lso included in the present invention are polynucleotides having sequence identity of at least 50%  at least 55%  at least 60%  at least 65%  at least 70%  at least 75%  at least 80%  at least 85%  at least 86%  at least 87%  at least 88%  at least 89%  at least 90%  at least 91%  at least 92%  at least 93%  at least 94%  at least 95%  at least 96%  at least 97%  at least 98%  or at least 99%  sequence identity to an identified reference nucleic acid sequence  such as with any of SEQ ID NOs: 2  4  6  8  10  12  14  16  18  20  22  24  26  28  30  32  34  36  38  and 40. The nucleic acids of the present invention  isolated or synthesized in accordance with the sequences disclosed herein are useful in the recombinant production of P. gingivalis peptides or polypeptides.

The nucleic acids of this invention may be obtained directly from the DN? of a P. gingivalis strain (such as for example  but not limited to  P. gingivalis strains W83  W50 and ?TCC33277) and any other P. gingivalis strain carrying the applicable DN? gene sequence by using the polymerase chain reaction (PCR) (as described in PCR  A Practical Approach" (McPherson  Quirke  and Taylor  eds. IRL Press Oxford  UK  1991) or by using alternative standard techniques that are recognized by one skilled in the art. One embodiment of the invention provides isolated nucleic acids molecules having a sequence corresponding to any of SEQ ID NOs: 2 4 6 8 10  12 14 16  18  22  24  26  28  30  32  34  36  38  and 40. The invention encompasses sequence-conservative variants and function-conservative variants of these sequences.

The polypeptides of the present invention encompass those encoded by the disclosed isolated nucleic acids including the polypeptides of SEQ ID NOs. 1  3  5  7  9  1 1  13  15  17  19  21  23  25  27  29  31  35  37  and 39 and their variants. The polypeptides of the present invention  including function-conservative variants  preferably correspond to proteins which are surface accessible on P. gingivalis .

The polypeptides of the present invention can be produced using standard molecular biology techniques and expression systems (see for example  Molecular Cloning: A Laboratory Manual  Third Edition by Sambrook et. ah  Cold Spring Harbor Press  2001). For example  the gene (or the fragment of a gene) that encodes an immunogenic polypeptide may be isolated and the

polynucleotides encoding the immunogenic polypeptide may be cloned into any commercially available expression vector (such as  e.g.  pBR322 and pUC vectors (New England Biolabs  Inc.  Ipswich  MA) or expression/purification vectors (such as e.g.  GST fusion vectors (Pfizer  Inc.  Piscataway  N. J.  or those described in the Examples herein) and then expressed in a suitable prokaryotic  viral or eukaryotic host. Purification may then be achieved by conventional means  or in the case of a commerical expression/purification system  in accordance with manufacturer""s instructions.

Alternatively  the polypeptides of the present invention  including variants  may be isolated for example  but without limitation  from wild-type or mutant P. gingivalis cells  or throughchemical synthetization using commercially automated procedures  such as for example  exclusive solid phase synthesis  partial solid phase methods  fragment condensation or solution synthesis.

Polypeptides of the present invention preferably have immunogenic activity. "Immunogenic activity" refers to the ability of a polypeptide to elicit an immunoglical response in a subject. ?n immunological response to a polypeptide is the development in a subject of a cellular and / or antibody mediated immune response to the polypeptide. Usually  an immunogical response includes but is not limited to one or more of the following effects: the product of antibodies  B cells  helper T cells  suppressor T cells and / or cytotoxic T cells  directed to an epitope or epitodes of the polypeptide. The term "Epitope" refers to the site on an antigen to which specific B cells and / or T cells respond so that antibody is produced. The immunogenic activity may be protective. The term "protective immunogenic activity" refers to the ability of a polypeptide to elicit an immunogical response in a subject that prevents or inhibits infection by P.gingivalis.

A polypeptide of the present invention may be characterized by molecular weight  mass fingerprint  amino acid sequence  nucleic acid sequence that encodes the polypeptide  immunological activity  or any combination of two or more such characteristics. The molecular weight of a polypeptide  typically expressed in kilodaltons (kDa)  can be determined using routine methods including  for instance  gel filtration  gel electrophoresis including sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis (P?GE)  capillary electrophoresis  mass spectrometry  liquid chromatography (including HPLC)  and calculating the molecular weight from an observed or predicted amino acid sequence.

In one embodiment  nucleic acids encoding a polypeptide such as any of SEQ ID NOs. 1  3  5  7  9  1 1  13  15  17  19  21  23  25  27  29  31  35  37  and 39 or variants thereof are provided. Also provided are variants of such sequences  including degenerate variants thereof. In certain embodiments  a nucleic acid molecule encoding the polypeptide and/or fragment thereof may be inserted into one or more expression vectors  as discussed below in greater detail. In such embodiments  the polypeptide and/or fragment is/are encoded by nucleotides corresponding to the amino acid sequence. The particular combinations of nucleotides that encode the various amino acids are well known in the art  as described in various references used by those skilled in the art (.e.g.  Lewin  B. Genes V  Oxford University Press  1994  and later editions)  as shown in Table 1 below. Nucleic acid variants may use any combination of nucleotides that encode the polypeptide of interest.

TABLE 1

The immunogenic polypeptides of PG0495  PG0654  PG 1374  PG1795  PG2172  PG0613  PG1326  PG 1798  PG0186 and PG0616 described herein include immunogenic fragments and variants of such polypeptides and/or fragments. Variants may comprise amino acid modifications. For example  amino acid sequence modifications include substitutional  insertional or deletion changes. Substitutions  deletions  insertions or any combinantion thereof may be combined in a single variant so long as the variant is immunogenic. Insertions include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amion acid residues.

Insertions ordinarily will be smaller instertions than those of amino or carboxyl terminal fusions  for example  on the order of one to four residues. Deletions are characterized by the removal or one or more amino acid residues from the protein sequence. Typically no more than about from 2 to 6 residues are deleted at any one site within the protein molecule. These variants ordinarily are prepared by site specific mutagenesis of nucleotides in the DN? encoding the protein  thereby producing DN? encoding the variant and thereafter expressing the DN? in a recombinant cell culture.

Techniques for making substitutional mutations at predetermined sites in DN? having a known sequence are well known and include  but are not limited to  M 13 primer mutagenesis and

PCT mutagenesis. ?mino acid substitutions are typically single residues but can occur at a number of different locations. Substitutional variants are those in which at least one residue has been removed and a different residue inserted in its place. Such substitutions generally are made in accordance with the following Table 2 and are referred to as conservative substitutions (although non-conservative substitutions are also possible). Others are well known to those of skill in the art.

Conservative amino acid substitutions may involve a substitution of a native amino acid residue with a non-native residue such that there is little or no effect on the size  polarity  charge  hydrophobicity  or hydrophilicity of the amino acid residue at that position and  in particular  does not result in decreased immunogenicity. Suitable conservative amino acid substitutions are shown in Table 2.

TABLE 2

The specific amino acid substitution selected may depend on the location of the site selected. In certain embodiments  nucleotides encoding polypeptides and /or fragments substituted based on the degeneracy of the genetic code (i.e  consistent with the "Wobble" hypothesis). Where the nucleic acid is a recombinant DN? molecule useful for expressing a polypeptide in a cell (e.g.  an expression vector)  a Wobble-type substitution will result in the expression of a polypeptide with the same amino acid sequence as that originally encoded by the DN? molecule. ?s described above  however  substitutions may be conservative  or non-conservative  or any combination thereof.

? skilled artisan will be able to determine suitable variants of the polypeptides and /or fragments provided herein using well-known techniques. For identifying suitable areas of the molecule that may be changed without destroying biological activity (e.g  immunogenicity  MHC binding  red blood cell (RBC) agglutination  RBC hemolysis)  one skilled in the art may target areas not believed to be important for that activity. For example  when derivatives with similar activities from the same species or from other species are known  one skilled in the art may compare the amino acid sequence of a polypeptide to such similar polypeptides. By performing such analyses  one can identify residues and portions of the molecules that are conserved. It will be appreciated that changes in areas of the molecule that are not conserved relative to such similar derivatives would be less likely to adversely affect the biological activity and/or structure of a polypeptide. However  modifications resulting in decreased binding to MHC will not be appropriate in most situations. One skilled in the art would also know that  even in relatively conserved regions  one may substitute chemically similar amino acids for the naturally occurring residues while retaining the desired characteristics of the polypeptide and / or fragment. Therefore  even areas that may be important for biological activity or for structure may be subject to conservative amino acid substitutions without destroying the biological activity or without adversely affecting the structure of the derivative.

Analogs can differ from naturally occurring P. gingivalis polypeptides in amino acid sequence and/or by virtue of non-sequence modifications. Non-sequence modifications include changes in acetylation  methylation  phosphyorylation  carboxylation  or glycosylation. ?

"modification" of a polypeptide of the present invention includes polypeptides (or analogs thereof  such as  e.g. fragments thereof) that are chemically or enzymatically derivitzed at one or more constituent amino acid. Such modifications can include  for example  side chain modifications  backbone modifications  and N- and C- terminal modifications such as  for example  acetylation  hydroxylation  methylation  amidation  and the attachment of carbonhydrate or lipid moieties  cofactors  and the like  and combinations thereof. Modified polypeptides of the invention may retain the biological activity of the unmodified polypeptides or may exhibit a reduced or increased biological activity.

Polypeptide sequence similarity and polypeptide sequence identity

Structural similarity of two polypeptides can be determined by aligning the residues of the two polypeptides (for example  a candidate polypeptide and the polypeptide of  for example  SEQ ID NO: 1) to optimize the number of identical amino acids along the length of their sequences; gaps in either or both sequences are permitted in making the alignment in order to optimize the number of identical amino acids  although the amino acids in each sequence must nonetheless remain in their

proper order. ? candidate polypeptide is the polypeptide being compared to the reference polypeptide. ? candidate polypeptide can be isolated  for example  from a microbe (e.g.  P.

gingivalis)  or can be produced using a recombinant techniques  or chemically or enzaymatically synthesized.

? pair-wise comparison analysis of amino acids sequences can be carried out using a global algorithm for example Needleman-Wunsch. Alternatively  polypeptides may be compared using a local alignment algorithm such as the Blastp program of the BLAST 2 search algorithm  as described by Tatiana et al.  (FEMS Microbiol. Lett  174:247-250 (1999)  and available on the National Centre for Biotechnology Information (NCBl) website. The default values for all BLAST 2 search parameters may be used  including matrix = BLOSUM62; open gap penalty = 1 1  extension gap penalty = 1  gap x dropoff = 50  expect 10  wordsize = 3  and filter on. The Smith and Waterman algorithm is another local alignment tool that can be used (1988).

In comparison of two amino acid sequences  structural similarly may be referred to by precent "identity" or may be referred to by percent "similarity." "Identity" refers to the presence of identical amino acids. Unless otherwise stated  the term "percent identity" means that a pair-wise comparison analysis of two amino acids was carried out using a global algorithm. "Similarity" refers to the presence of not only identical amino acids but also the presence of conservative substitutions. A conservative substitution for an amino acid in a polypeptide of the invention may be selected from other members of the class to which the amino acid belongs  as shown on Table 2.

A polypeptide of the present invention can include a polypeptide with at least 50%  at least 55%  at least 60%  at least 65%  at least 70%  at least 75%  at least 80%  at least 85%  at least 86%  at least 87%  at least 88%  at least 89%  at least 90%  at least 91%  at least 92%  at least 93%  at least 94%  at least 95%  at least 96%  at least 97%  at least 98%  or least 99%  amino acid sequence identity to the reference amino acid sequence.

Fusions

In other embodiments  the polypeptides and / or fragments described herein may include fusion polypeptide segments that assist in purification or detection of the polypeptides. Fusions can be made either at the amino terminus or at the carboxy terminus of the subject polypeptide variant thereof. Fusions may be direct with no linker or adapter molecule or may be through a linker or adapter molecule. A linker or adapter molecule may be one or more amino acid residues  typically from about 20 to about 50 amino acid residues. A linker or adapter molecule may also be designed with a cleavage site for a DNA restriction endonuclease or for a protease to allow for the separation of the fused moieties. It will be appreciated that once constructed  the fusion polypeptides can be derived according to the methods described herein. Suitable fusion segments include  among others  metal binding domains (e.g.  a poly histidine segment)  immunoglobulin binding domains (i.e.  Protein ?  Protein G  T cell  B cell  Fc receptor  or complement protein antibody binding domains)  sugar binding domains (e.g.  a maltose binding domain)  and/or a "tag" domain (i.e.  at least a portion of galactosidase  a strep tag peptide  a T7 tag peptide  a FL?G peptide  or other domains that can be purified using compounds that bind to the domain  such as monoclonal antibodies). This tag is typically fused to the polypeptide upon expression of the polypeptide  and can serve as a means for affinity purification of the sequence of interest polypeptide from the host cell. Affinity purification can be accomplished  for example  by column chromatography using antibodies against the tag as an affinity matrix. Optionally  the tag can subsequently be removed from the purified sequence of interest polypeptide by various means such as using certain peptidases for cleavage. Examples of fusion proteins with a segment/domain attached at the N-terminus to aid in purification are provided here (see e.g.  SEQ ID NOs: 21  23  25  27  29  31  35  37  and 39).

In certain embodiments  the polypeptides and /or fragments may be directly or indirectly (i.e.  using an antibody) labeled or tagged in a manner which enables it to be detected. Labels include fluorochromes such as fluorescein  rhodamine  phycoerythrin  Europium and Texas Red 

chromogenic dyes such as diaminobenzidine  radioisotopes  macromolecular colloidal particles or particulate material such as latex beads that are coloured  magnetic or paramagnetic  binding agents such as biotin and digoxigenin  and biologically or chemically active agents that can directly or indirectly cause detectable signals to be visually observed  electronically detected or otherwise recorded  for example in a F?CS  EL1S?  Western blot  TRF1?  immunohistochemistry  evanescence  Luminex bead array  or dipstick or other lateral flow assay format. Suitable antibody-binding molecules for use in such methods may include immunoglobulin-binding antibodies  for example anti-human Ig antibodies  anti -human Ig antibodies  anti-human antibodies specific for Ig isotypes or for subclasses of IgG  or specific for P. gingivalis proteins.

Preferred fluorescent tag proteins include those derived from the jelly fish protein known as green fluorescent protein (GFP). Further information on GFP and other fluorophores is given in the following publications: Tsien R Y  "The Green Fluorescent Protein" Annual Reviews of Biochemistry 1998; 67:509-544 Verkhusha  V and Lukyanov  K. "The Molecular Properties and Applications of ?nthoza Fluorescent Proteins and Chromophores" Nature Biotechnology 2004; 22:289- 296. Plasmid vectors encoding a wide range of fluorescent tag proteins are commercially available from various suppliers including an array of "Living Colours™ Fluorescent Proteins" available

commercially from Clontech Laboratories  Inc. Similar vectors can also be obtained from other suppliers including Invitrogen and ?mersham Biosciences. Suitable fluorescent proteins derived from GFP are the red-shifted variant EGFP  the cyan shifted variant ECFP and the yellow shifted variant EYFP. EGFP is preferred as the fluorescent marker because it gives bright fluorescence combined with minimal effect on the antigenic properties of the target antigen. Alternative fluorescent marker proteins are commercially available. Biologically or chemically active agents include enzymes  which catalyse reactions that develop or change colours or cause changes in electrical properties  for example  and may also be utilized. They may be molecularly excitable  such that electronic transitions between energy states result in characteristic spectral absorptions or emissions. They may include chemical entities used in conjunction with biosensors. Biotin/avidin or biotin/streptavidin and alkaline phosphatase detection systems may be employed. Further examples include horseradish peroxidase and chemiluminescence. In some embodiments  the non-immobilised antibody-binding molecule or polypeptide may be detected using an antibody which binds to said non- immobilised antibody-binding molecule or polypeptide. ? suitable detection antibody may be labeled by means of fluorescence. The label may be a fluorescent marker (tag) which is used to label the target antigen directly such that the antigen and the fluorescent marker form a fusion protein.

If antibodies against the target antigen are present in a biological sample  the antigen may be labeled with the tag bound to those antibodies  and the complex formed thereby detected using immunoprecipitation. The fluorescence associated with the tag may then be used to determine that protein has been precipitated (qualitative determination) or to determine the amount of protein precipitated (quantitative determination). For example  soluble extracts of a fluorescence-tagged antigen may be incubated with patient sera for an appropriate period of time such as overnight at 4°C (typically 10 - 15µl of serum to 300 - 500µl of extract or less) to allow antibodies to bind to the antigen. Protein ? or Protein G Sepharose beads  preincubated with low IgG fetal calf serum (Sigma) to block non-specific binding  are then added to the extract/serum mix containing the tagged protein/antibody complexes  and mixed with gentle rotation for 1 to 2 hours at room temperature. The antibodies within the serum  including those that specifically bind the tagged protein  are bound by the protein ?/G beads. The protein ?/G Sepharose beads are then washed in a suitable buffer (typically 10 niM Tris-HCl pH 7.4  100 niM NaCl/ ImM EDT?/ 1% Triton X- 100) to remove any unbound tagged protein. This may be achieved by three rounds of centrifugation  removal of the supernatant  and resuspension in buffer. The beads  some with tagged protein attached  are then collected and placed in a fluorescence reader  for example a Spectra Max Gemini XS plate reader from Molecular Devices Inc. The presence of specific autoantibodies/antibodies in the original

serum sample is quantitated. In the case of GFP this uses excitation at wavelength 472nm and emission at 512nm. The fluorescence excitation will depend upon the fluorophore/tag that is used but it would be possible to combine several different tagged proteins in the same time. For example  different P. gingivalis polypeptides (and/or fragments thereof) may be separately tagged and separately or simultaneously assayed. The sensitivity of the method is dependent on the detection device and can be considerably enhanced by using more sensitive detection devices. Various modifications of these methods could also be utilized.

The assays described herein for detecting antibodies immunoreactive with P. gingivalis antigens may also be combined with other assays useful for detecting P. gingivalis infection. For instance  these assays (i.e.  EL1S?) may be combined with polymerase chain reaction (PCR) assays for detecting P. gingivalis nucleic acid in a biological sample. Alternatively  an EL1S? assay may be combined with an immunoprecipitation assay  or a PCR-based assay may be combined with an immunoprecipitation assay. Combining the various assays described herein may serve to even further increase the sensitivity of detection and further decrease the negative predictive value of the data.

Express ion Vectors

The present invention further provides for the use of expression vectors. Expression vectors are typically comprised of a flanking sequence operably linked to a heterologous nucleic acid sequence encoding a polypeptide (the "coding sequence"). In other embodiments  or in combination with such embodiments  a flanking sequence is preferably capable of effecting the replication  transcription and/or translation of the coding sequence and is operably linked to a coding sequence. To be "operably linked" indicates that the nucleic acid sequences are configured so as to perform their usual function. For example  a promoter is operably linked to a coding sequence when the promoter is capable of directing transcription of that coding sequence. The promoter elements that may be present include those naturally associated with the nucleotide sequence encoding the polypeptide and exogenous elements not associated with the nucleotide sequence.

? flanking sequence need not be contiguous with the coding sequence  so long as it functions correctly. Thus  for example  intervening untranslated yet transcribed sequences can be present between a promoter sequence and the coding sequence and the promoter sequence can still be considered operably linked to the coding sequence. Flanking sequences may be homologous (i.e.  from the same species and/or strain as the host cell)  heterologous (i.e.  from a species other than the host cell species or strain)  hybrid (i.e.  a combination of flanking sequences from more than one source)  or synthetic. ? flanking sequence may also be a sequence that normally functions to

regulate expression of the nucleotide sequence encoding the polypeptide in the genome of the host may also be utilized.

? cultured cell comprising the vector is also provided. The cultured cell may be a cultured cell transfected with the vector or a progeny of the cell  wherein the cell expresses the immunogenic polypeptide. Suitable cell lines are known to those of skill in the art and are commercially available  for example  through the American Type Culture Collection (?TCC). The P. gingivalis nucleotide sequences can be expressed in a variety of expression systems  such as for example  those used with mammalian cells  baculoviruses  plants  bacteria and yeast. The transfected cells can be used in a method of producing an immunogenic polypeptide. The method comprises culturing a cell comprising the vector under conditions that allow expression of the polypeptide  optionally under the control of an expression sequence. The polypeptide can be isolated from the cell or the culture medium using standard protein purification methods.

Delivei? Techniques

In certain embodiments  it is preferred that the flanking sequence is a transcriptional regulatory region that drives high-level gene expression in the target cell. The transcriptional regulatory region may comprise  for example  a promoter  enhancer  silencer  repressor element  or combinations thereof. The transcriptional regulatory region may be either constitutive or tissue- or cell-type specific {i.e.  the region drives higher levels of transcription in one type of tissue or cell as compared to another). ?s such  the source of a transcriptional regulatory region may be any prokaryotic or eukaryotic organism  any vertebrate or invertebrate organism  or any plant  provided that the flanking sequence is functional in  and can be activated by  the host cell machinery. ? wide variety of transcriptional regulatory regions may be utilized.

Suitable transcriptional regulatory regions include  among others  the CMV promoter (i.e.  the CMV-immediate early promoter); promoters from eukaryotic genes (i.e.  the estrogen-inducible chicken ovalbumin gene  the interferon genes  the gluco-corticoid-inducible tyrosine aminotransferase gene  and the thymidine kinase gene); and the major early and late adenovirus gene promoters; the SV40 early promoter region (Bernoist and Chambon  1981  Nature 290:304-10); the promoter contained in the 3"" long terminal repeat (LTR) of Rous sarcoma virus (RSV) (Yamamoto  et al.  1980  Cell 22:787-97); the herpes simplex virus thymidine kinase (HSV-TK) promoter (Wagner et al.  1981  Proc. Natl. ?cad. Sci. U.S.A. 78: 1444-45); the regulatory sequences of the metallothionine gene (Brinster et al.  1982  Nature 296:39-42); prokaryotic expression vectors such as the beta-lactamase promoter ( Villa- Kamaroff et al.  1978  Proc. Natl. ?cad. Sci. U.S.?.  75:3727-31); or the tac promoter (DeBoer et al.  1983  Proc. Natl. ?cad. Sci. U.S.A.  80:21-25). Tissue- and / or cell-type specific transcriptional control regions include  for example  the elastase 1 gene control region which is active in pancreatic acinar cells (Swift et al.  1984  Cell 38:639-46; Ornitz et al.  1986  Cold Spring Harbor Symp. Quant. Biol. 50:399-409 (1986); MacDonald  1987  Hepatology 7:425-515); the insulin gene control region which is active in pancreatic beta cells (Hanahan  1985  Nature 315: 1 15-22); the immunoglobulin gene control region which is active in lymphoid cells (Grosschedl et al.  1984  Cell 38:647-58; ?dames et al.  1985  Nature 318:533-38; Alexander et al.  1987  MoI. Cell. Biol.  7: 1436-44); the mouse mammary tumor virus control region in testicular  breast  lymphoid and mast cells (Leder et al.  1986  Cell 45:485-95); the albumin gene control region in liver (Pinkert et al.  1987  Genes and Devel. 1 :268-76); the alpha-feto-protein gene control region in liver (Krumlauf et al.  1985  MoI. Cell. Biol.  5: 1639-48; Hammer et al.  1987  Science 235:53-58); the alpha 1-antitrypsin gene control region in liver (Kelsey et al.  1987  Genes and Devel. 1 : 161-71); the beta-globin gene control region in myeloid cells (Mogram et al.  1985  Nature 315:338-40; Kollias et al.  1986  Cell 46:89-94); the myelin basic protein gene control region in oligodendrocyte cells in the brain (Readhead et al.  1987  Cell 48:703-12); the myosin light chain-2 gene control region in skeletal muscle (Sani  1985  Nature 314:283-86); and the gonadotropic releasing hormone gene control region in the hypothalamus (Mason et al.  1986  Science 234: 1372-78)  and the tyrosinase promoter in melanoma cells (Hart  1. Semin Oncol 1996 Feb;23(l): 154-8; Siders  et al. Cancer Gene Ther 1998 Sep-Oct;5(5):281-91). Other suitable promoters are known in the art.

The nucleic acid molecule may be administered as part of a viral and non-viral vector. In one embodiment  a DN? vector is utilized to deliver nucleic acids encoding the targeted immunogen and / or associated molecules (i.e.  co-stimulatory molecules  cytokines or chemokines) to the patient. In doing so  various strategies may be utilized to improve the efficiency of such mechanisms including  for example  the use of self- replicating viral replicons (Caley  et al. 1999. Vaccine  17: 3124-2135; Dubensky  et al. 2000. MoI. Med. 6: 723-732; Leitner  et al. 2000. Cancer Res. 60: 51-55)  codon optimization (Liu  et al. 2000. MoI. Ther.  1 : 497-500; Dubensky  supra; Huang  et al. 2001. J. Virol. 75: 4947-4951)  in vivo electroporation (Widera  et al. 2000. J. Immunol. 164: 4635-3640)  incorporation of nucleic acids encoding co-stimulatory molecules  cytokines and / or chemokines (Xiang  et al. 1995. Immunity  2: 129-135; Kim  et al. 1998. Eur. J. Immunol.  28: 1089-1 103; Iwasaki  et al. 1997. J. Immunol. 158: 4591-3601; Sheerlinck  et al. 2001. Vaccine  19: 2647-2656)  incorporation of stimulatory motifs such as CpG (Gurunathan  supra; Leitner  supra)  sequences for targeting of the endocytic or ubiquitin-processing pathways (Thomson  et al. 1998. J. Virol. 72: 2246-2252; Velders  et al. 2001. J. Immunol. 166: 5366-5373)  prime-boost regimens

(Gurunathan  supra; Sullivan  et al. 2000. Nature  408: 605-609; Hanke  et al. 1998. Vaccine  16:

439-445; ?mara  et al. 2001. Science  292: 69-74)  proteasome-sensitive cleavage sites  and the use of mucosal delivery vectors such as Salmonella (Darji  et al. 1997. Cell  91 : 765-775; Woo  et al. 2001. Vaccine  19: 2945-2954). Other methods are known in the art  some of which are described below.

Various viral vectors that have been successfully utilized for introducing a nucleic acid to a host include retrovirus  adenovirus  adeno-associated virus (??V)  herpes virus  and poxvirus  among others. It is understood in the art that many such viral vectors are available in the art. The vectors may be constructed using standard recombinant techniques widely available to one skilled in the art. Such techniques may be found in common molecular biology references such as Molecular Cloning: ? Laboratory Manual (Sambrook  et al.  1989  Cold Spring Harbor Laboratory Press)  Gene

Expression Technology (Methods in Enzymology  Vol. 185  edited by D. Goeddel  1991. Academic Press  San Diego  C?)  and PCR Protocols: ? Guide to Methods and Applications (Innis  et al. 1990. Academic Press  San Diego  CA).

Preferred retroviral vectors are derivatives of lenti virus as well as derivatives of murine or avian retroviruses. Examples of suitable retroviral vectors include  for example  Moloney murine leukemia virus (MoMuLV)  Harvey murine sarcoma virus (HaMuSV)  murine mammary tumor virus (MuMTV)  SlV  BlV  HlV and Rous Sarcoma Virus (RSV). A number of retroviral vectors can incorporate multiple exogenous nucleic acid sequences. As recombinant retroviruses are defective  they require assistance in order to produce infectious vector particles. This assistance can be provided by  for example  helper cell lines encoding retrovirus structural genes. Suitable helper cell lines include P?317 and P?12  among others. The vector virions produced using such cell lines may then be used to infect a tissue cell line  such as NlH 3T3 cells  to produce large quantities of chimeric retroviral virions. Retroviral vectors may be administered by traditional methods (i.e.  injection) or by implantation of a "producer cell line" in proximity to the target cell population (Culver  K.  et al.  1994  Hum. Gene Ther.  5 (3): 343-79; Culver  K.  et al.  Cold Spring Harb. Symp. Quant. Biol.  59: 685-90); Oldfield  E.  1993  Hum. Gene Ther.  4 (1): 39-69). The producer cell line is engineered to produce a viral vector and releases viral particles in the vicinity of the target cell. A portion of the released viral particles contact the target cells and infect those cells  thus delivering a nucleic acid to the target cell. Following infection of the target cell  expression of the nucleic acid of the vector occurs.

Adenoviral vectors have proven especially useful for gene transfer into eukaryotic cells (Rosenfeld  M.  et al.  1991  Science  252 (5004): 431-3; Crystal  R.  et al.  1994  Nat. Genet.  8 (1): 42-51)  the study of eukaryotic gene expression (Levrero  M.  et al.  1991  Gene  101 (2): 195-202) 

vaccine development (Graham  F. and Prevec  L.  1992  Biotechnology  20: 363-90)  and in animal models (Stratford-Perricaudet  L.  et al.  1992  Bone Marrow Transplant.  9 (Suppl. 1): 151-2 ; Rich  D.  et al.  1993  Hum. Gene Ther.  4 (4): 461-76). Experimental routes for administering recombinant ?d to different tissues in vivo have included intratracheal instillation (Rosenfeld  M.  et al.  1992  Cell  68 (1): 143-55) injection into muscle (Quantin  B.  et al.  1992  Proc. Natl. ?cad. Sci. U.S.A.  89 (7): 2581-3)  peripheral intravenous injection (Herz  J.  and Gerard  R.  1993  Proc. Natl. ?cad. Sci. U.S.A.  90 (7): 2812-6) and stereotactic inoculation to brain (Le Gal La Salle  G.  et al.  1993  Science  259 (5097): 988-90)  among others.

?deno-associated virus (??V) demonstrates high-level infectivity  broad host range and specificity in integrating into the host cell genome (Hermonat  P.  et al.  1984  Proc. Natl. ?cad. Sci. U.S.A.  81 (20): 6466-70). And Herpes Simplex Virus type-1 (HSV- I) is yet another attractive vector system  especially for use in the nervous system because of its neurotropic property (Geller  A.  et al.  1991  Trends Neurosci.  14 (10): 428-32; Glorioso  et al.  1995  MoI. Biotechnol.  4 (1): 87-99; Glorioso  et al.  1995  ?nnu. Rev. Microbiol.  49: 675-710).

Poxvirus is another useful expression vector (Smith  et al. 1983  Gene  25 (1): 21-8; Moss  et al  1992  Biotechnology  20: 345-62; Moss  et al  1992  Curr. Top. Microbiol. Immunol.  158: 25-38; Moss  et al. 1991. Science  252: 1662-1667). Poxviruses shown to be useful include vaccinia  NYV?C™  avipox  fowlpox  canarypox  ?LV?C™  and ?LV?C(2)  among others.

NYV?C™ (vP866) was derived from the Copenhagen vaccine strain of vaccinia virus by deleting six nonessential regions of the genome encoding known or potential virulence factors (see  for example  U.S. Pat. Nos. 5 364 773 and 5 494 807). The deletion loci were also engineered as recipient loci for the insertion of foreign genes. The deleted regions are: thymidine kinase gene (TK; J2R) vP410; hemorrhagic region (u; B13R+B14R) vP553; ? type inclusion body region (?T1; ?26L) vP618; hemagglutinin gene (H?; ?56R) vP723; host range gene region (C7L-K1L) vP804; and  large subunit  ribonucleotide reductase (14L) vP866. NYV?C™ is a genetically engineered vaccinia virus strain that was generated by the specific deletion of eighteen open reading frames encoding gene products associated with virulence and host range. NYV?C™ has been show to be useful for expressing T?s (see  for example  U.S. Pat. No. 6 265 189). NYV?C™ (vP866)  vP994  vCP205  vCP1433  placZH6H4Lreverse  pMPC6H6K3E3 and pC3H6FHVB were also deposited with the ?TCC under the terms of the Budapest Treaty  accession numbers VR-2559  VR-2558  VR-2557  VR-2556  ?TCC-97913  ?TCC-97912  and ?TCC-97914  respectively.

?LV?C-based recombinant viruses (i.e.  ?LV?C- 1 and ?LV?C-2) are also suitable for use

(see  for example  U.S. Pat. No. 5 756 103). ?LV?C(2) is identical to ?LV?C( l) except that

?LV?C(2) genome comprises the vaccinia E3L and K3L genes under the control of vaccinia promoters (U.S. Pat. No. 6  130 066; Beattie et al.  1995a  1995b  1991; Chang et al.  1992; Davies et al.  1993). Both ?LV?C(l) and ?LV?C(2) have been demonstrated to be useful in expressing foreign DN? sequences  such as T?s (Tartaglia et al.  1993 a b; U.S. Pat. No. 5 833 975). ?LV?C was deposited under the terms of the Budapest Treaty with the American Type Culture Collection (?TCC)  10801 University Boulevard  Manassas  Va. 201 10-2209  US?  ?TCC accession number VR-2547.

Another useful poxvirus vector is the TROV?C™ vector. TRO V?C™ refers to an attenuated fowlpox that was a plaque-cloned isolate derived from the FP-I vaccine strain of fowlpoxvirus which is licensed for vaccination of 1 day old chicks. ? sample of the TROV?C™ vector was deposited under the terms of the Budapest Treaty with the ?TCC  accession number 2553.

"Non-viral" plasmid vectors may also be suitable in certain embodiments. Preferred plasmid vectors are compatible with bacterial  insect  and / or mammalian host cells. Such vectors include  for example  PCR-Il  pCR3  and pcDN?3.1 (Invitrogen  San Diego  C?)  pBSll (Stratagene  La Jolla  C?)  pET15 (Novagen  Madison  Wl)  pGEX (Pharmacia Biotech  Piscataway  NJ)  pEGFP-N2 (Clontech  Palo ?lto  C?)  pETL (BlueBacll  Invitrogen)  pDSR-alpha (PCT pub. No. WO 90/14363) and pFastBacDual (Gibco-BRL  Grand Island  NY) as well as Bluescript® plasmid derivatives (a high copy number COLEl -based phagemid  Stratagene Cloning Systems  La Jolla  C?)  PCR cloning plasmids designed for cloning Taq-amplified PCR products (e.g.  TOPO™ T? cloning® kit  PCR2.1® plasmid derivatives  Invitrogen  Carlsbad  C?). Bacterial vectors may also be used. These vectors include  for example  Shigella  Salmonella  Vibrio cholerae  Lactobacillus  Bacille calmette guerin (BCG)  and Streptococcus (see for example  WO 88/6626; WO 90/0594; WO 91/13157; WO 92/1796; and WO 92/21376). Many other non-viral plasmid expression vectors and systems are known in the art and may be used.

Other delivery techniques may also suffice including  for example  DN?-ligand complexes  adenovirus-ligand-DN? complexes  direct injection of DN?  CaPO4 precipitation  gene gun techniques  electroporation  and colloidal dispersion systems. Colloidal dispersion systems include macromolecule complexes  nanocapsules  microspheres  beads  and lipid-based systems including oil-in-water emulsions  micelles  mixed micelles  and liposomes. The preferred colloidal system is a liposome  which are artificial membrane vesicles useful as delivery vehicles in vitro and in vivo. RN?  DN? and intact virions can be encapsulated within the aqueous interior and be delivered to cells in a biologically active form (Fraley  R.  et al.  1981  Trends Biochem. Sci.  6: 77). The composition of the liposome is usually a combination of phospholipids  particularly high-phase-

transition-temperature phospholipids  usually in combination with steroids  especially cholesterol. Other phospholipids or other lipids may also be used. The physical characteristics of liposomes depend on pH  ionic strength  and the presence of divalent cations. Examples of lipids useful in liposome production include phosphatidyl compounds  such as phosphatidylglycerol 

phosphatidylcholine  phosphatidylserine  phosphatidyletha^nolamine  sphingolipids  cerebrosides  and gangliosides. Particularly useful are diacylphosphatidylglycerols  where the lipid moiety contains from 14-18 carbon atoms  particularly from 16-18 carbon atoms  and is saturated. Illustrative phospholipids include egg phosphatidylcholine  dipalmitoylphosphatidylcholine and

distearoylphosphatidylcholine.

P. gingivalis Polypeptide-specific Antibodies

This disclosure further relates to antibodies  preferably protective and/or neutralizing antibodies  generated using one of PG0495  PG0654  PG 1795  PG2172  PG0613  PG1326  PG1798  PGO 186  or PG0616 or a fragment or variant thereof where the resultant antibodies are reactive to  or specifically bind to the P. gingivalis polypeptide and /or its fragments or variants. ?lso provided are methods for eliciting the production of antibodies  which may be protective  and/or neutralizing  and reactive to the P. gingivalis polypeptide and/or its fragments. The antibodies may elicit both active and passive immunity. The polypeptides and / or fragments thereof may also be used to identify and isolate antibodies  which may be protective and / or neutralizing  that are cross-reactive with those elicited by native P. gingivalis proteins.

Preferably  a purified antibody is separated from at least about 60%  75%  80%  85%  90%  or 95% of the proteins with which it is initially found. Suitable derivatives may include fragments (i.e.  Fab  Fab2 or single chain antibodies such as Fv for example)  as are known in the art. The antibodies may be of any suitable origin or form including  for example  murine (i.e.  produced by murine hybridoma cells)  or expressed as humanized antibodies  chimeric antibodies  human antibodies  and the like.

Methods of preparing and utilizing various types of antibodies are well-known to those of skill in the art and would be suitable for use (see  for example  Harlow  et al. Antibodies: ?

Laboratory Manual  Cold Spring Harbor Laboratory  1988; Harlow  et al. Using Antibodies: ? Laboratory Manual  Portable Protocol No. 1  1998; Kohler and Milstein  Nature  256:495 (1975)); Jones et al. Nature  321 :522-525 (1986); Riechmann et al. Nature  332:323-329 (1988); Presta (Curr. Op. Struct. Biol.  2:593-596 ( 1992); Verhoeyen et al. (Science  239: 1534-1536 (1988); Hoogenboom et al.  J. MoI. Biol.  227:381 (1991); Marks et al.  J. MoI. Biol.  222:581 ( 1991); Cole et al.  Monoclonal Antibodies and Cancer Therapy  ?lan R. Liss  p. 77 (1985); Boerner et al.  J. Immunol.  147(l):86-95 (1991); Marks et al.  Bio/Technology 10  779-783 (1992); Lonberg et al.  Nature 368 856-859 ( 1994); Morrison  Nature 368 812- 13 (1994); Fishwild et al.  Nature Biotechnology 14  845-51 ( 1996); Neuberger  Nature Biotechnology 14  826 (1996); Lonberg and Huszar  Intern. Rev. Immunol. 13 65-93 (1995); as well as U.S. Pat. Nos. 4 816 567; 5 545 807; 5 545 806; 5 569 825; 5 625  126; 5 633 425; and  5 661 016). In certain applications  the antibodies may be contained within hybridoma supernatant or ascites and utilized either directly as such or following concentration using standard techniques. In other applications  the antibodies may be further purified using  for example  salt fractionation and ion exchange chromatography  or affinity chromatography using Protein ?  Protein G  Protein ?/G  and / or Protein L ligands covalently coupled to a solid support such as agarose beads  or combinations of these techniques. The antibodies may be stored in any suitable format  including as a frozen preparation (i.e.  -2O0C? or -7O0C)  in lyophilized form  or under normal refrigeration conditions (e.g.  40C). When stored in liquid form  it is preferred that a suitable buffer such as Tris-buffered saline (TBS) or phosphate buffered saline (PBS) is utilized. Antibodies and their derivatives may be incorporated into compositions described herein for use in vitro or in vivo. Other methods for making and using antibodies available to one of skill in the art may also be suitable for use.

Compositions

The disclosed polypeptides and the nucleic acids encoding these polypeptides are useful inter alia as components in immunogenic compositions (also referred to as immunological compositions) such as  for example  vaccine compositions. ?n immunogenic composition is one that  upon administration to a subject (e.g.  a mammal)  induces or enhances an immune response directed against the antigen (or immunogen) contained within the composition. This response may include the generation of antibodies (e.g.  through the stimulation of B cells) or a T cell-based response (e.g.  a cytolytic response). These responses may or may not be protective or neutralizing. ? protective or neutralizing immune response is one that is detrimental to the infectious organism corresponding to the antigen (i.e.  from which the antigen was derived) and beneficial to the host (e.g.  by reducing or preventing infection). ?s used herein  protective or neutralizing antibodies may be reactive to the corresponding wild-type P.gingivalis antigen or fragments thereof from which the polypeptide (or fragments thereof) were derived and reduce or inhibit the lethality of the corresponding P.gingivalis antigen when tested in animals. ?n immunogenic composition that  upon administration to a subject  results in a protective or neutralizing immune response may be considered a vaccine. The vaccine composition may serve prophylactic and/or therapeutic purposes. Immunogenic compositions (e.g.

vaccines) containing one or more of the P. gingivalis polypeptides (antigens) of the present invention may be used to treat and/or prevent periodontal diseases such as  for example  periodontitis and gingivitis. The immune response need not provide complete protection and/or treatment against the disease.

Preferred embodiments of the immunogenic compositions of the present invention include compositions comprising one or more of the following proteins: PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG 1326  PG1798  PG0186 and PG0616. ? further preferred embodiment is an immunogenic composition comprising a polypeptide having at least 80%  85%  90%  91%  92%  93%  94%  95%  96%  97%  98%  99% or 100% identity to SEQ ID NO: 1  3  5  7  9  1 1  13  15  17  19  32  34  36  38  40  42  44  46  48  and 50.

Certain embodiments of the compositions of the present invention are described in Example 6. Preferred prophylactic compositions of the present invention are those which when administered to an animal elicit a Th2-antibody biased response; such a response has been associated with protection in the prophylactic alveolar bone loss mouse model (J. Immunol. 2008 Sep. 15; 181(6):4150-8).

Compositions (e.g.  vaccine compositions) of the present invention may be administered in the presence of absence of an adjuvant. Adjuvants generally are substances that can enhance the immunogenicity of antigens. Adjuvants may play a role in both acquired and innate immunity and may function in a variety of ways  not all of which are understood.

Adjuvants may also be included in the compositions and methods described herein to stimulate or enhance the immune response. Non-limiting examples of suitable classes of adjuvants include those of the gel-type [e.g..  aluminum hydroxide  aluminum phosphate ("aluminum adjuvants")  calcium phosphate  microbial origin (muramyl dipeptide (MDP)]  bacterial exotoxins [?f.g.cholera toxin (CT)  native cholera toxin subunit B (CTB)  E. coli labile toxin (LT)  pertussis toxin (PT)  CpG oligonucleotides  BCG sequences  tetanus toxoid  monophosphoryl lipid A (MPL) of  for example  E. coli  Salmonella minnesota  Salmonella typhimitriitm  or Shigella e.xseri]  particulate adjuvants (e.g. biodegradable  polymer microspheres)  immunostimulatory complexes (ISCOMs))  oil-emulsion and surfactant-based adjuvants [Freund""s incomplete adjuvant (FlA)  microfluidized emulsions (e.g. MF59  SAF)  saponins (e.g. QS-21)]  synthetic muramyl peptide derivatives (murabutide  threony-MDP)  nonionic block copolymers (e.g. L 121)  polyphosphazene (PCCP)  synthetic polynucleotides (poly A :U  poly 1 :C)  thalidomide derivatives (CC-4407/ACTlMlD))  RH3-ligand  or polylactide glycolide (PLGA) microspheres  among others.

Fragments  homologs  derivatives  and fusions to any of these described toxins are also suitable  provided that they retain adjuvant activity. Suitable mutants or variants of adjuvants are described  e.g.  in WO 95/1721 1 (?rg-7- Lys CT mutant)  WO 96/6627 (?rg-192-Gly LT mutant)  and WO 95/34323 (?rg-9-Lys and Glu-129-Gly PT mutant). Additional LT mutants that may used include  for example  Ser-63-Lys  ?la-69-Gly Glu-l 10-?sp  and GIu-1 12-?sp mutants.

Aluminum salt adjuvants (or compounds) are among the adjuvants of use in the practice of the invention. Examples of aluminum salt adjuvants of use include aluminum hydroxide (e.g.  crystalline aluminum oxyhydroxide ?IO(OH)  and aluminum hydroxide Al(OH)3. In particular embodiments  the aluminum adjuvant is aluminum oxyhydroxide (e.g.  Alhydrogel"). It is well known in the art that compositions with aluminum salt adjuvants should not be exposed to extreme temperatures  i.e. below freezing (O0C) or extreme heat (e.g.  > 70 0C) as such exposure may adversely affect the stability and the immunogenicity of both the adsorbed antigen and adjuvant.

Metallic salt adjuvants such as aluminum adjuvants are well-known in the art as providing a safe excipient with adjuvant activity. The mechanism of action of these adjuvants are thought to include the formation of an antigen depot such that antigen may stay at the site of injection for up to 3 weeks after administration  and also the formation of antigen/metallic salt complexes which are more easily taken up by antigen presenting cells. In addition to aluminium  other metallic salts have been used to adsorb antigens  including salts of zinc  calcium  cerium  chromium  iron  and berilium. The hydroxide and phosphate salts of aluminium are the most common. Formulations or compositions containing aluminium salts  antigen  and an additional immunostimulant are known in the art. An example of an immunostimulant is 3-de-O-acylated monophosphoryl lipid A (3D-MPL). Another example is the product E6020 (having CAS Number 287180-63-6). In certain embodiments  the composition includes aluminum hydroxide and E6020. Product E6020 is described in

US2007/0082875 (which is incorporated herein by reference in its entirety).

In one embodiment of adjuvanted immunization  for example  polypeptides and / or fragments thereof may be covalently coupled to bacterial polysaccharides to form polysaccharide conjugates. Such conjugates may be useful as immunogens for eliciting a T cell dependent immunogenic response directed against the bacterial polysaccharide conjugated to the polypeptides and / or fragments thereof.

One or more cytokines may also be suitable co-stimulatory components for use with the compositions of the present invention  either as polypeptides or as encoded by nucleic acids

(Parmiani  et al. Immunol Lett 2000 Sep 15; 74(1): 41-3; Berzofsky  et al. Nature Immunol. 1 : 209-219). Suitable cytokines include  for example  interleukin-2 (1L-2) (Rosenberg  et al. Nature Med. 4: 321-327 (1998))  1L-4  1L-7  1L- 12 (reviewed by Pardoll  1992; Harries  et al. J. Gene Med. 2000 JuI- ?ug;2(4):243-9; Rao  et al. J. Immunol. 156: 3357-3365 (1996))  IL- 15 (Xin  et al. Vaccine  17:858- 866  1999)  IL- 16 (Cruikshank  et al. J. Leuk Biol. 67(6): 757-66  2000)  IL- 18 (J. Cancer Res. Clin. Oncol. 2001. 127(12): 718-726)  GM-CSF ((Disis  et al. Blood  88: 202-210 (1996))  tumor necrosis factor-alpha (TNF-a)  and interferon- gamma (INF-?). Other cytokines may also be suitable for use  as is known in the art.

In certain embodiments  the composition is administered in the presence of an adjuvant that comprises an oil-in-water emulsion comprising at least squalene  an aqueous solvent  a

polyoxyethylene alkyl ether hydrophilic nonionic surfactant  a hydrophobic nonionic surfactant  wherein said oil-in-water emulsion is obtainable by a phase inversion temperature process and wherein 90% of the population by volume of the oil drops has a size less than 200 nm  and optionally less than 150 nm. Such an adjuvant is described in WO2007006939 (Vaccine Composition

Comprising a Thermoinversable Emulsion) which is incorporate herein in its entirety. The composition may also include the product E6020 (having C?S Number 287180-63-6)  in addition to  or instead of the described squalene oil-in-water emulsion.

In certain embodiments  the composition includes a TLR agonist (e.g.  TLR4 agonist) alone or together in combination with an adjuvant. For example  the adjuvant may comprise a TLR4 agonist (e.g.  TL?4)  squalene  an aqueous solvent  a nonionic hydrophilic surfactant belonging to the polyoxyethylene alkyl ether chemical group  and a nonionic hydrophobic surfactant and may be thermoreversible. Examples of such adjuvants are described in WO2007080308 (Thermoreversible Oil-in- Water Emulsion) which is incorporated herein in its entirety. In one embodiment  the composition is adjuvanted with a combination of CpG and an aluminum salt adjuvant (e.g.  aluminum hydroxide).

Pharmaceutical Formulations

The compositions of the present invention are preferably in liquid form  but they may be lyophilized (as per standard methods) or foam dried (as described in WO2009012601  ?ntigen-?djuvant Compositions and Methods). ? composition according to one embodiment of the invention is in a liquid form. ?n immunization dose may be formulated in a volume of between 0.5 and 1.0 ml. Liquid formulations may be in any form suitable for administration including for example  a solution  or suspension.

The pharmaceutical formulations of the compositions of the present invention may also optionally include a "pharmaceutically acceptable carrier." The term "pharmaceutically acceptable carrier" refers to a material that is not biologically or otherwise undesirable  (i.e.  the material may be administered to a subject  without causing any undesirable biological effects or interacting in a

deleterious manner with any of the other components of the pharmaceutical composition in which it is contained). The carrier would naturally be selected to minimize any degradation of the active ingredient (e.g.  immunogenic polypeptide) and to minimize any adverse side effects in the subject  as would be well known to one of skill in the art.

Suitable carriers and their formulations are described in Remington: The Science and Practice of Pharmacy  21st Edition  David B. Troy  ed.  Lippicott Williams & Wilkins (2005). Typically  an appropriate amount of a pharmaceutically-acceptable salt is used in the formulation to render the formulation isotonic. Examples of the pharmaceutically-acceptable carriers include  but are not limited to  sterile water  saline  buffered solutions like Ringer""s solution  and dextrose solution. The pH of the solution is generally from about 5 to about 8 or from about 7 to about 7.5. Other carriers include sustained-release preparations such as semipermeable matrices of solid hydrophobic polymers containing polypeptides or fragments thereof. Matrices may be in the form of shaped articles  e.g.  films  liposomes or microparticles. It will be apparent to those persons skilled in the art that certain carriers may be more preferable depending upon  for instance  the route of administration and concentration of composition being administered. Carriers are those suitable for administration of polypeptides and/or fragments thereof to humans or other subjects.

The pharmaceutical formulations of the compositions of the present invention may also optionally include one or more excipients (e.g.  diluents  thickeners  buffers  preservatives  surface active agents  detergents  and/orimmunostimulants) which are well known in the art. Suitable excipients will be compatible with the antigen and with any adjuvant present in the composition as is well known in the art. Examples of diluents include binder  disintegrants  or dispersants such as starch  cellulose derivatives  phenol  polyethylene glycol  propylene glycol or glycerin. Examples of detergents include a Tween (polysorbate) such as Tween 80. Pharmaceutical compositions may also include one or more active ingredients such as antimicrobial agents  antiinflammatory agents and anesthetics. Suitable excipients for inclusion in the compositions of the invention are known in the art.

The compositions may be formulated for use orally such as  for example  but not limited to  as a toothpaste  toothpowder  liquid dentrifice  gingival cream  gel  capsule  lozenge and chewing gum.

Compositions may be presented in a kit form comprising the composition and instructions for use. In one example  the composition is presented in a kit comprising the composition and an adjuvant or a reconstitution solution comprising one or more pharmaceutically acceptable diluents to facilitate reconstitution of the composition for administration to a mammal using conventional or

other devices. Such a kit may optionally include the device for administration of the liquid form of the composition (e.g. hypodermic syringe  microneedle array) and/or instructions for use.

Method of Use

The prophylactic and therapeutic methods of the invention involve vaccination with one or more of the disclosed immunogenic polypeptides in  for example  carrying out the treatment itself  in preventing subsequent infection  or in the production of antibodies for subsequent use in passive immunization.

The immunogenic compositions of the invention find use in methods of preventing or treating a disease  disorder  condition or symptoms associated with P. gingivalis. The terms disease  disorder and condition will be used interchangeably herein. Specifically  the prophylactic and therapeutic methods comprise administration of a therapeutically effective amount of a pharmaceutical composition to a subject. In particular embodiments  methods for preventing or treating periodontal disease associated with a symptomatic P. gingivalis infection are provided.

?s used herein  preventing a disease or disorder is intended to mean administration of a therapeutically effective amount of a pharmaceutical composition of the invention to a subject in order to protect the subject from the development of the particular disease or disorder associated with P. gingivalis.

By treating a disease or disorder is intended administration of a therapeutically effective amount of a pharmaceutical composition of the invention to a subject that is afflicted with a disease caused by P. gingivalis or that has been exposed to P. gingivalis where the purpose is to cure  heal alleviate  relieve  alter  remedy  ameliorate  improve  or affect the condition or the symptoms of the disease.

? therapeutically effective amount refers to an amount that provides a therapeutic effect for a given condition and administration regimen. ? therapeutically effective amount can be determined by the ordinary skilled medical worker based on patient characteristics (age  weight  gender  condition  complications other diseases etc.). The therapeutically effective amount will be further influenced by the route of administration of the composition.

Compositions of the invention can be administered by an appropriate route such as for example  percutaneous (e.g.  intramuscular  intravenous  intraperitoneal or subcutaneous)  transdermal  mucosal or topical  in amounts and in regimes determined to be appropriate by those skilled in the art.

The methods include administering to a subject an effective amount of a composition of the present invention. In some aspects  the methods may further include additional administration (e.g.  one or more booster administrations) of the compositions to the subject to enhance or stimulate a secondary immune response. ? booster can be administered at a time after the first administration  for instance  one to eight weeks  preferably two to four weeks  after the first administration of the composition. Subsequently boosters can be administrated one  two  three four or more times annually. Without intending to be limited by theory  it is expected that in some aspects of the present invention annual boosters will not be necessary  as a subject will be challenged in the field by exposure to microbes (P. gingivalis) expressing polypeptides present in the compositions and having epitopes that are identical to  or structurally related to  epitopes present on polypeptides of the composition administered to the subject.

In one aspect  the invention is directed to methods for making antibodies  for instance by inducing the production of the antibody in a subject  or by recombinant techniques. The antibody produced includes antibody that specifically binds at least one epitope of at least one polypeptide present in the composition. In this aspect of the invention  an "effective amount" is an amount effective to result in the production of antibody in the subject. Methods determining whether a subject has produced antibodies that specifically bind polypeptides present in a composition of the present invention are well known in the art and can be determined as described herein. The present invention further includes antibody that specifically bind to a polypeptide of the present invention  and compositions including such antibodies.

The method may be used to produce antibody that specifically binds polypeptides expressed by a microbe (P. gingivalis) from which the polypeptide of the composition were isolated. ?s used herein  an antibody that can "specifically bind" a polypeptide is an antibody that interacts with the epitope of the antigen that induced the synthesis of the antibody  or interacts with a structurally related epitope. ?t least some of the polypeptides present in the compositions of the present invention typically include epitopes that are conserved in the polypeptides of different strain species. Accordingly  antibody produced using a composition derived from one strain of P. gingivalis is expected to bind to the polypeptides expressed by other P. gingivalis strains and provide broad system protection against this gram negative organism.

Also disclosed  is a method of reducing the risk of a periodontal disease in a subject comprising administering to the subject an immunogenic compoisition comprising one or more of the disclosed immunogenic polypeptides. Periodontal diseases (symptomatic infections) include for

example  periodontitis. The risk of any symptomatic P. gingivalis infection (or the recurrence of any such symptomatic P. gingivalis infection) may be reduced by the methods described herein.

Diagnosic kits

?lso  provided herein are kits for detecting the presence of a P. gingivalis infection in a patient by detecting antibodies or nucleic acid in a biological sample of the patient. In one embodiment  one or more antigens {e.g.  polypeptides and /or fragment thereof) may form part of a kit for detecting or diagnosing an?-P. gingivalis antibodies in a biological sample. The antigens may be provided in a suitable container such as a vial in which the contents are protected from the external environment. Thus  a kit for detecting an anti-P. gingivalis antibody in a sample may comprise one or more P. gingivalis polypeptides and /or fragments thereof along with one or more detection reagents for determining binding of one or more antibodies in a sample to the antigen is provided. The kit preferably includes: (i) one or more isolated and purified polypeptides and /or fragments thereof; and  (ii) a system for detecting the formation of an antigen-antibody complex  optionally packaged with instructions for use. The antigen may be free in solution or may be immobilized on a solid support  such as a magnetic bead  tube  microplate well  or chip. In certain embodiments  a solid matrix comprising an isolated and purified polypeptides and /or fragments thereof or a fusion protein or protein aggregate adsorbed thereto is provided. In some embodiments  the kit may further comprise an antibody-binding molecule as a detection reagent. The antibody-binding molecule may be a capture or detection reagent and may be free in solution or may be immobilized on a solid support  such as a magnetic bead  tube  microplate well  or chip. The antibody-binding molecule or polypeptide may be labeled with a detectable label  for example a fluorescent or chromogenic label or a binding moiety such as biotin. Suitable labels are described in more detail above. The kit may further comprise detection reagents such as a substrate  for example a chromogenic  fluorescent or chemiluminescent substrate  which reacts with the label  or with molecules  such as enzyme conjugates  which bind to the label  to produce a signal  and / or reagents for immunoprecipitation). The detection reagents may further comprise buffer solutions  wash solutions  and other useful reagents. The kit may also comprise one or both of an apparatus for handling and/or storing the sample obtained from the subject and an apparatus for obtaining the sample from the subject {e.g. a needle  lancet  and collection tube or vessel). The kit may also include instructions for use of the antigen  {e.g. in a method of detecting a.nti-P. gingivalis antibodies in a test sample)  as described herein. Where the assay is to be combined with another type of assay such as PCR  the required reagents for such an assay {i.e.  primers  buffers and the like) along with  optionally  instructions for the use thereof  may also be included.

?ll references cited within this disclosure are hereby incorporated by reference in their entirety. Certain embodiments are further described in the following examples. These embodiments are provided as examples only and are not intended to limit the scope of the claims in any way.

EXAMPLES

The above disclosure generally describes the present invention. ? more complete understanding can be obtained by reference to the following specific Examples. These Examples are described solely for purposes of illustration and are not intended to limit the scope of the invention. Changes in form and substitution of equivalents are contemplated as circumstances may suggest or render expedient. Although specific terms have been employed herein  such terms are intended in a descriptive sense and not for purposes of limitations. Methods of molecular genetics  protein biochemistry and immunology used  but not explicitly described in this disclosure and these

Examples  are amply reported in the scientific literatures and are well within the ability of those skilled in the art.

Example 1: Mining of P. gingival is genome

This example describes the genome mining exercise that was conducted to identify immunogenic polypeptides of P. gingival is. The genome of P. gingival is strain W83 has

approximately 2200 open reading frames. Using computer-assisstance  the proteins comprising the P.gingivalis W83 genome (http://cmr.jcvi. org/cgi-bin/CMR/GenomePage.cgi?org=gpg) were each assessed using the following parameters to prioritize those proteins for further evaluation (by cloning  expression and purification):

1. Candidates with a C-terminal domain (CTD) were prioritized for further evaluation. The presence of the CTD has been shown in the P.gingivalis proteinase  RgpB  to be required for its proper maturation  correct secreation and attachment to the cell surface (Nguyen et al.  J. of Bacteriology  2007 189 833-843).

2. PSORTb localization  from high to low priority: (outer membrane or extracellular) > (unknown) > (periplasmic or cytoplasmic). Psortb (version 2.0) is a web-based bacterial protein subcellular localization prediction tool [available at www.psort.org; J. L. Gardy  M. R. Laird  F. Chen  S. Rey  CJ. Walsh  M. Ester  and F. S. L. Brinkman (2005) PSORTb v.2.0: expanded prediction of bacterial protein subcellular localization and insights gained from comparative proteome analysis 

Bioinformatics 21(5):617-623]

3. Other parameters favouring a higher priority to be applied to the protein:

i. the presence of a signal sequence;

ii. strain prevalence (i.e. presence in P.gingivalis strains W50  W83 and strain ?TCC

33277);

iii. high (75%) sequence conservation amoung strains with a published sequenced genome (e.g. W83  ?TCC 33277);

iv. published articles disclosing data indicating the protein is localized in the outer membrane  and/or is a potential virulence factor;

4. Other parameters favouring a lower priority to be applied to the protein:

i. detectable human sequence similarity;

ii. predicted transmembrane helices;

iii. molecular weight >100 kDa or <20 kDa

iv. predicted subcellular localization

Using these priorization parameters  approximately 131 protein candidates were identified for evaluation. Each of the candidates were then cloned from P. gingivalis strain W50 (deposited as ?TCC 53978) and expressed recombinantly in Escherichia coli  as explained in more detail in Example 2. Those which were expressed solubly (i.e. approximately 40 proteins)  were selected for further evaluation.

Example 2: Recombinant cloning  expression and purification of P. gingivalis proteins

Selected genes from Polymorphomonas gingivalis strain W50 (e.g. PG 0495  PG 2172  PG 1326  PG 1374  PG 0654  PG 0613  PG 1798  PG 0186  PG 1795  PG 0616) were recombinantly cloned  expressed and purified.

The primers set out in Table 4 below were designed to amplify the relevant gene (full-length but lacking signal sequence) from P gingivalis W50 strain. The amplified gene products were cloned into pET-30 Ek/LlC (Novagen\ Merck  Germany) with the pET-30 Ek/LlC Vector Kit. Using this vector the expressed product has a vector-encoded S-tag to facilitate expression analysis and a vector encoded N-terminal tag (mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddk SEQ ID NO:51). Based on the cloning requirements for the vector  the next amino acid must be either a Met (m) or an lie (i)  so either of those residues was also added in cases where it was not the first native amino acid of the desired fragment to be cloned. Digestion with enterokinase enables the removal of all vector-encoded sequences from the target protein  but for initial screening purposes  the tags were not removed.

The signal peptide sequences for each of the genes were predicted using SignallP

(http://www.cbs.dtu.dk/services/SignalP/) or were assigned based upon the typical P. gingivalis type 1 signal cleavage site consensus as previously described and identied (J. Bacteriol. 2006 Sept.:

188( 17):6376-6386). The genes were cloned such that the resulting cloned nucleotide sequence lacked the signal peptide sequence. Signal peptide sequences can be predicted in a number of ways as is known in the art  including through the use of prediction software such as that available at
(Locating proteins in the cell using Target P  SignalP  and related tools  O. Emanuelsson  S. Brunak  G. von Heijne  H. Nielsen  Nature Protocols 2  953-971 (2007)).

The resulting vectors were each subcloned into the NovaBlue competent cells and subsequently the resulting plasmids were each transformed into E. coli strain BL21 (DE3) for protein production using Overnight Express™ ?utoinduction System 1 (Novagen). Upon IPTG induction the recombinant polypeptides were expressed.

Following expression  the solubility of the expressed polypeptides were assessed using SDS-P?GE and/or the FRETWorks™ S-Tag™ assay kit (Novagen  according to manufacturer""s recommendations). The basis for this assay is that the S-tag fusion peptide from any soluble recombinant protein is able to provide trans-complementation to the exogenously added purified mutant version of the S protein to restore RNase activity. The substrate FRET ?rU?? fluoresces when cleaved by the reconstituted RNase and provides a fluorescence readout.

Solubly expressed polypeptides were purified by affinity chromatography using Ni2~-NT? agarose under native conditions using a commercially available kit (Qiagen" ). Subsequent SDS-P?GE analysis with Commassie Blue staining was performed in respect of each recombinanlty cloned polypeptide and in each case a single band was noted with the approximate molecular weight noted in Table 3 below.

Table 3

Table 4

PCR Primers

? person skilled in the art will appreciate that the nucleotide sequences could be cloned with the signal peptide sequence. Similarly  a person skilled in the art will appreciate that the polypeptides can each be recombinantly expressed without the vector encoded S-tag and His-tag by using a different plasmid cloning vector. It should be noted however that with respect to PG 0616  the polypeptide is capable of being expressed solubly by cloning the gene  without the signal peptide sequence into the pET-30 Ek/LlC whereas the polypeptide was not soluble when expressed with the signal peptide.

rPG0495

The gene was cloned from the W50 strain as described above. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:41). The sequence of the expressed protein is set out as

SEQ ID NO:21. The nucleotide sequence of the cloned gene (set out as SEQ ID NO:22) is identical to that of W83 apart from the following changes:

i) bp 130 is a "T" in the cloned gene  wherease it is an "?" in the published W83 sequence. This results in a MET to LEU substituation at this codon.

ii) bp 861 is a "G" in the cloned gene  whereas it is an "?" in the published W83 sequence. This is a silent mutation as both GCG and GC? encode alanine.

iii) There is an "?" missing after bp 1440 which results in a frame shift with the following consequences: the C-terminal 7 amino acids should be TERVlVQ*  wherease in the protein encoded by the cloned gene these are replaced by QKE*. This frame shift is a cloning artifact.

Below is the amino acid sequence of the rPG0495 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKLQTMAPNYFHADPOOFKHRIVKE

KSFSSYSNYEYGVDNRLQRIYSVDESSGEIEHERRFFFNEGGYMIREEEYDGTVQIPVRKWEFVRDDKG

YITHFSRYSPKDGSQELIEDIRIDFSYD?DMKLIK?DIDFFDIM?NVWGDLRTTKLVYNENGLLKEMIQT

DPGSGQEFNREELTYNNLNKIV?IRFIPGP?STGLNEFELIYEYDSEGMDIVK?GRDDFWYYYEYDKEM

L?SETFFPKPSI?DLVYFGLKDYVDFSGLPFKNSYTHVVVKESTNEVE?IYEPISVYSVVVIQPENGEIKL

T?DGQPLNSGSTLV?GRRIKIHPIP?EGYEVDKVMVNGENIE?PYEFLLEKDTEVT?LMKKSN?VGEV

DTKGFHVYPIPTSKDLTIEIP?EMVGKV?SLIDMNGQIVYRVTLNNIFQQIDISHLKGVFLLQIGDIQKE

(SEQ 1D NO:21)

rPG2172

The gene was cloned from the W50 strain as described above. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:47). The sequence of the expressed protein is set out as SEQ ID NO:29. The nucleotide sequence of the W50 cloned gene (set out in SEQ ID NO:30) is identical to the corresponding W83 sequence from the published genome.

Below is the amino acid sequence of the rPG2172 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGLVPRGSGMKET?AAKFERQHMDSPDLGTDDDDKMQVVIKVGD?ILENN?TVDIT?F

TTEDGTEEMKFEGMVINQS?TPINVIGKITKQEMIGDGHF?LCFGQCMGPNVSVSPIVEALDGEGEYVS

LHYKFPVSNEGHTG?FTFSCFPESG?PGTEL?TVNINFKYKGGGTGLTNIGLGRI?LIQSGNTCTLQYNS

NGKRLALEVYNLLGVKVFTSOLPAGSGSYTLPVRLORGVHIFRITEGGKPAFVOKYLIK (SEO ID

NO:29)

rPG 1326

The gene was cloned from the W50 strain as described above. The sequence of the expressed protein is set out as SEQ ID NO:39. The sequence of the W50 cloned gene (set out as SEQ ID NO:40) is identical to the corresponding W83 sequence from the published genome. Below is the amino acid sequence of the rPG 1326 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFERQHMDSPDLGTDDDDKMLCENTL?OOKTEEF?PVSDLR?

E?YGSTVFLHWTPPYDNPMIPLSESFESGIP?IWKTIDADGDGYNWMHLTNFTGQSGLCVSS?SYIGGV

G?LTPDNYLITPELKLPTD?LVEIIYWVCTQDLT?PSEHY?VYSSSTGNN?ADFVNLLYEETLT?KRIQS

PELIRGNRTQG VWYQRKVVLPNDTKYV?FRHFNSTDNFWLNLDEVSILYTPLPRR?PCPHPGGYTYSV

FRDGQKI?SGLS?L?YIDTDVPYGTQDYCVQVNYLQGDSYKVCKNIVV?NS?NIYG?DKPF?LTVVG

KTIVAS?FKGEITLYDIRGRLI?SGCDTLRYK?ENGFYLIKIQVNGTVYTEKIQIQ (SEQ ID NO:39)

rPG0654

The gene was cloned from the W50 strain. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:43). The sequence of the expressed protein is set out as SEQ ID NO:25.The sequence of the W50 cloned gene (set out as SEQ ID NO:26) is identical to the corresponding W83 sequence from the published genome. Below is the amino acid sequence of the rPG0654 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFEROHMDSPDLGTDDDDKMOSPRIPQVDVHTRI?RN?RYRL

DKISVPDSRQIFDYFYKEETIPTKIQTTTGG?ITSIDSLFYEDDRLVQVRYFDNNLELKQ?EKYVYDGSK

LVLREIRKSPTDETPIKKVSYHYLCGSDMPFEITTEMSDGYFESHTLNYLNGKI?RIDIMTQQNPSAELIE

TGRMVYEFD?NND? VLLRDSVFLPLQNKWVEMFTHRYTYDNKHNCIRWEQDEFGTLTLANNFEYDT

TIPLSSVLFPTHEEFFRPLLPNFMKHMRTKQTYFNNSGEGLSEVCDYNYFYTDMQGN?LTDV? VNESIK

IYPRP?TDFLRIEGSQLLRLSLFDMNGKLIR?TELTGDL?IIGV?SLPRGTYIAEIT?ANSKTIR?KVSLR

(SEQ 1D NO:25)

rPG 1374

The gene was cloned from the W50 strain. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:44). The sequence of the expressed protein is set out as SEQ ID NO:27. The sequence of the cloned gene (set out as SEQ ID NO:28) is identical to the corresponding sequence of

W83 apart from as follows:

i) bp 481 is a "T" in the cloned gene  wherease it is a "C"  in the published W83 sequence. This is a silent mutation  as both CTG and TTG encode LEU (i.e. the proteins are 100% identical).

Below is the amino acid sequence of the rPG 1374 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFEROHMDSPDLGTDDDDKMQFVP?PTTGIRMSVTTTK? VGE

KLIELL VHSIEKKGIWIDLNGD?TYQQGEEITVFDE?YHEYTIGTQTLTIYGNTTRLGCRSTG?T? VD VTK

NPNLTYL?CPKNNLKSLDLTQNPKLLRVWCDSNEIESLDLSGNP?LIILGCDRNKLTELKTDNNPKL?S

LWCSDNNLTELELS?NPRLNDLWCFGNRITKLDLS?NPLLVTLWCSDNELSTLDLSKNSDV?YLWCSS

NKLTSLNLSG VKGLSVL VCHSNQI?GEEMTKVVN?LPTLSPG?G?QSKFVVVDLKDTDEKNICTVKD

VEK?KSKNWRVFDFNGDSDNMLPYEGSPTSNL?VD?PTVRIYPNPVGRY?LVEIPESLLGQE??LYD

MNGVKVYSF? VESLRQNIDLTHLPDGTYFFRLDNYTTKLIKQ (SEQ ID NO:27)

rPG 1795

The gene was cloned from the W50 strain. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:48). The sequence of the expressed protein is set out as SEQ ID NO:31.The sequence of the W50 cloned gene (set out as SEQ ID NO:32) is identical to the W83 sequence from the published genome.

Below is the amino acid sequence of the rPG 1795 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFERQHMDSPDLGTDDDDKMQSLSTIKVQNNSVQQPREE?TI

QVCGEL?EQVDCIGTGNS?II?AA?KFESDDLESYVGWEIMSVDFFPGYKACKYTS?VW?DDMTILG

QSEDSDPEMQTINNL?LKTSVKIE?GKNYIVGYI?NTAGGHPIGCDQGP? VDGYGDL VSISEDGG?TFP

PFESLHQA VPTLNYNIYVVVHLKKGEGVE?VLTNDK?N?YVQNGVIYVAG?NGRQVSLFDMNGKVV

YTGVSET1?APQKGMY1LRVG?KS1KLAI (SEQ ID NO:31)

rPG0613

The gene was cloned from the W50 strain as described above. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:49). The sequence of the expressed protein is set out as SEQ ID NO:33. The sequence of the W50 cloned gene (set out as SEQ ID NO:34) is identical to the W83 sequence from the published genome.

Below is the amino acid sequence of the rPG0613 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFERQHMDSPDLGTDDDDKMQTTTNSSRSYFTGRIEKVSLNLG

VPPVSTEVWGMTHD?NGLPFEIPISFSRFNSQGDI?TTYYI?NSE?TLNEWCDY?HPGGIVRVEGRFWK

MTYNIPTYN?VCTRITFENQEIEGTIVLIPKPKVSLPHVSESVPCIRTE?GREFILCEEDDTFVSHDGNEVT IGGKPFLLNTNVKIVGDVSQKY?VGVGEIRFLQIC?QTVSQQK (SEQ ID NO: 33)

rPG1798

The gene was cloned from the W50 strain as described above. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:46). The sequence of the expressed protein is set out as

SEQ ID NO:35. The sequence of the cloned gene (set out as SEQ ID NO:36) is identical to that of

W83 apart from the following changes:

i) ?n error was introduced at the 3"" end of the gene during PCR amplification (in the primer). The net result is that the protein expressed is missing its last 2 native amino acids and an additional ~56 amino acids have been added (encoded from the vector). The predicted correct sequence of the plasmid is set out as SEQ !D NO:45.

Below is the amino acid sequence of the rPG1798 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFERQHMDSPDLGTDDDDKMQTKDNSSYKPFSKEDI?GG VYS

LPTQNR?QKDN?EWLLT?TVSTNQS?DTHFIFDENNRYI?RDIK?NGVRKSTDSIYYD?NGRISHVDL

YISFSGGEP?LDTRFKYTYDDEGKMTVREVFMLVMDPNTPISRLEYHYD?QGRLTHWISF?FG?ESQK

NTYHYNEKGLL VSEVLSN?MGTTYSDTGKTEYSYDD?DNMVK?EYFVVQQGK?WQVLKREEYTYE

DNICIQYL?INGTDTKVYKRDIESDKSIS?NVIDIPSMPEQTWPNMYGFN?KRLKETYSSYEGDV?TPIF

DYIYTYK?LTSM?TPSTE?QV?VYLNPSTDRLVILANGITHLSMYDLQGKLIRDC?LSGDKVKMGVGS

LTKGTYLLKVNTDQG?FVRKVVFDDR?SPQPWRYRIRIR?PSTSLRPHSSTTTTTTEIRLLTKPERKLSW

LLPPLSNN (SEQ ID NO: 35)

rPG0186

The gene was cloned from the W50 strain as described above. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:50). The sequence of the expressed protein is set out as SEQ ID NO:37. The sequence of the insert of the plasmid pE?G037 (the cloned gene; set out as SEQ ID NO: 38) was 100% correct as predicted from the W83 sequence.

Below is the amino acid sequence of the rPG0186 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFERQHMDSPDLGTDDDDKMCELDRDPEGKDFQQPYTSFVQT

KQNRDGL Y?LLRNTENPRMHFYQELQSDMYCTTITDGNSL?PFVNWDLGILNDHGR?DEDEVSGI?G

YYFVYNRLNQQ?N?FVNNTE?ALQNQVYKNSTEI?N?KSFL?EGKVLQ?L?IWRLMDRFSFHESVTE

VNSG?KDLGVILLKEYNPGYIGPR?TK?QCYDYILSRLSEAIEVLPENRESVLYVSRDY?Y?LR?RIYL ?LGEYGK??AD?KMVVDKYPLIG?AD?SEFHNIYRSD?NNPEIIFRGF?S?TLGSFT?TTLNG??P?G KDIKYNPS?VPFQWVVDLYENEDFRKSVYI?KVVKKDKGYLVNKFLEDK?YRDVQDKPNLKVG?RY FSVAEVYLILVES?LQTGDTPT?EKYLK?LSK?RG?EVSVVNME?LQ?ERTRELIGEGSRLRDMVRWS IPNNHDAFETQPGLEGF?NTTPLK?Q?PVGFY AYTWEFPQRDRQTNPQLIKNWPI (SEQ ID NO: 37).

rPG0616 (40 kDa OMP)

The gene was cloned from the W50 strain as described above. Plasmid DN? was isolated and sequenced (sequence set out as SEQ ID NO:42). The sequence of the expressed protein is set out as SEQ ID NO:23. The sequence of the W50 cloned gene (set out as SEQ ID NO:24) is identical to the corresponding W83 sequence from the published genome.

Below is the amino acid sequence of the rPG0616 protein that has been cloned and expressed (vector derived sequence is underlined).

MHHHHHHSSGL VPRGSGMKET?AAKFERQHMDSPDLGTDDDDKMQELKTS?DMKGSFKKNVVLEV

FT?EWCGYCPGGKERI?K?IEMLDDEYKERVFQTFVHYNDGISKKWPRVGQLFI?LDQTLGIPGFPTFS

VCRMEKKGENLSIG?PI?IKNKIMKGFGDGT?P?EVNLKLTKG?TPEDVCT?TFTGKVD?DLIGKPLM

LT?YVLKNNMKPINPQNG?GDGYLHQHTVLMILSTDVKGD?LNI?ADGSFTIKKEFKLDGFEIKDTDV

L?FVHHPMSN?ENHSIIN?GQESLDK?EPT?TEQIV?TPSVK?YVQNGKIVVEEEYSKMEVFN?TGQL

VKNESL VPGVYVVRIT?NGVMYFLKVL VP (SEQ ID NO: 23)

Example 3: Preparation of Protein-specific Antisera

Antibodies were raised in mice to certain recombinant proteins (e.g. rPG 0495  rPG 2172  rPG 1326  rPG 1374  rPG 0654  rPG 0613  rPG 1798  rPG 0186  rPG 1795  rPG 0616)  which had been prepared in accordance to the procedure set out in Example 2.

Mice (Balb/c) were immunized intermuscularly with a 50µl volume of 50µg of purified recombinant protein mixed 1/1 (vol/vol) with TiterMax" Gold adjuvant (CytRx Corporation  California  U.S.)  for a total injection volume of 100 µl to obtain anti-recombinant polyclonal serum. The TiterMax" Gold adjuvant is a water-in-oil emulsion that includes the block copolymer CRL-8300. The immunization protocol used was as follows:

(i) for each purified recombinant protein  a group of 3 mice were used;

(ii) on day -3  prebleed samples were obtained from each mouse

(iii) on day O mice were immunized intermuscularly with a 50 µg dose of purified recombinant protein (using 4 x 25 µl injections  one in each leg quadracep) with TiterMax" Gold.

(iv) on day 28 mice were immunized intermuscularly with a 25 µg dose of the same purified recombinant protein and with TiterMax" Gold (using 2 x 25 µl injections  one in each hind leg quadracep).

(v) Blood samples were obtained from mice following a two week period. Sera from each group was pooled.

The P. gingivalis specific antibody responses raised by each recombinant protein waere assessed by EL1S?. The results obtained from 3 separate studies are summarized in Figures Ia and Ib. ?s can be noted from Figures Ia and Ib  immunization with 50 µg of each recombinant protein in the presence of TiterMax R Gold elicits a P.gingivalis-specif?c IgG response.

Example 4: Detection of Protein in Outer Membrance of P. gingivalis

To assess whether the selected proteins were present in the outer membrane of P. gingivalis (and therefore accessible to antibodies)  Western immunoblots of P. gingivalis (W50) outer membrane fractions were probed with antisera raised to the recombinant proteins (obtained from one of the studies summarized in Example 3).

One protocol that was used to obtain whole cell lysates and outer membrane fractions is provided here. In general  the outer membrane fractions used in the Western immunoblots were obtained using a liquid culture of the P. gingivalis W50 strain grown anaerobically. Cells were harvested and fractionated using the detergent Sarkosyl (which selectively solubilizes the inner membrane such that  following Sarkosyl treatment  the Sarkosyl-insoluble material represents the outer membrane fraction.

P. gingivalis was grown in BHl media (supplemented with cysteine and hemin) at 37°C in an anaerobic chamber for ~5-6 days (until culture was turbid). Two 1.5 ml samples of culture was placed into two 2 separate tubes. One sample was centrifuged and the pellet was stored at -200C (to be used for whole cell lysate preparation). The second sample was also centrifuged  and the resulting pellet was resuspended in 5OmM sodium phosphate (NaP) (5mL NaP/ Ig cell paste) and stored at -200C. The whole cell lysate preparation was prepared by thawing pellets  resuspending each 300µL of 5OmM NaP + 300µL of 4 x UMS  and then boiling sample for approximately 10 min. The outer membrane fraction was prepared by thawing one of the pellets resuspended in 5OmM NaP  adding 5OmM NaP to a minimum volume of 2OmL (or the minimum volume required for the sonication apparatus)  adding lysozyme to a final concentration of lmg/mL. ? protease inhibitor tablet was added to the suspension  which was then sonicated on ice and then centrifuged to pellet the unlysed cells. Supernatant was removed. The pellet was resuspended in a 1% sarkosyl solution and incubated for approximately 30 min at room temperature on a rotating mixer and then centrifuged. The resulting supernatant  which contains the inner membrane fragments  was removed and the pellet was resuspended in a 0.5% sarkosyl solution and recentrifuged. The supernatant was extracted and the pellet was resuspended 5OmM NaP + UMS and then boiled. Samples were boiled before being run on gels. Samples were run on gel and each gel included a total of four lanes: (i) a control lane (with purified protein)  (ii) a molecular weight standard  (iii) a sample of whole cell lysate and (iv) a sample of the outer membrane fraction. Gels were transferred onto PVDF membranes and probed with the applicable antisera.

Each of PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG1326  PG1798  PG0186 and PG0616 was detected in the outer membrane fraction of P. gingivalis W50. Results are summarized in Figure 2.

Example 5: Assessment of Surface Exposure by Flow Cytometry Based Surface Accessiblity Assay

A flow cytometry based surface accessibility assay (S?SSY) was used to measure each protein""s accessibility on intact P. gingivalis cells to antibody binding. The protein-specific antisera used in this assay were obtained as described in Example 3. ? number of S?SSY experiments were performed and each was performed in accordance to the following protocol:

P. gingivalis strains (W50  W83  332277) were cultured substantially as described in Example 4; that is  strains were grown in BHl media (supplemented with cysteine and hemin) at 37°C in an anerobin chamber. In certain experiments  cells were harvested at various stages of growth  early logarithmic  logarithmic or stationary phase and the OD600 measured spectrophotometrically.

To carry out each assay study  a sample of culture was aliquoted into microfuge tubes and centrifuged. The supernatant was pipette-aspirated  and the pellet resuspended in 500 µL/1 mL input culture of 10% FBS and vortexed. The tubes were again centrifuged  the supernatant aspirated and the pellet resuspended in 10% FBS to yield a suspension of ~5E9 CFU/mL based on the estimated CFU/mL of the input culture. The primary antibody was incubated by aliquoting 190 µL/sample of ~5E9 CFU/mL washed bacteria and then adding to each 10 µL of one of the samples to be tested. Each sample was vortexed and then incubated at 37°C for approximately 30 minutes. Samples were then washed by adding 790 µL 10% FBS to each tube and then mixing by inversion  centrifuging tubes and pipette-aspirating supernatant.

The secondary antibody was incubated as follows: 5 µL of secondary antibody was diluted in DPBS [typically in a 1 : 1000 ratio]; 200 µL of diluted secondary antibody was added to each primary-antibody bound sample tube; each pellet was then resuspended by pipetting with a single-channel pipetter  and vortexed. ?s a control  a tube did not receive secondary antibody  but received 10% FBS instead. Tubes were incubated at room temperature for approximately 30 minutes in the dark. Samples were then washed by adding 10% FBS to each tube and mixing by inversion . Tubes were centrifuged and supernatant was pipette-aspirated. Each sample was fixed by adding % PF?.

Samples were stored at 2-8°C  in the dark.

?ntisera raised against Formalin- Killed W50 Whole Cells (FKWC) was used as a positive control (the generation of this sera is described in more detail in Example 6). ?F488-conjugated Goat anti-Mouse IgG was used to detect bound antisera.

Samples were acquired on a F?CS Calibur Flow cytometer (Becton Dickison). The cytometer used a 488nm wavelength band generated from an argon ion laser. Emission signals (?lexaFluor-488 for S?SSY and CFSE for OP?-uptake) were collected for each analysis which consisted of 10 000 gated events that were collected on the basis of size and granularity using CELLQuest Pro software (Becton Dickinson). Samples were analyzed using the FlowJo7.2.5 software

Figure 2 provides a summary of the results obtained from a number of separate experiments for each protein tested. Each dot set out along the Y axis represents the result obtained using that protein""s protein-specific antisera in one S?SSY experiment. Each horizontal dash set out along the Y axis represents the average result obtained in the all of the S?SSY experiments performed using that protein""s protein-specific antisera. Each of PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG1326  PG1798  PG0186 and PG0616 were detected by S?SSY as surface exposed on the P.gingivalis W50 strain at stationary phase.

The surface accessibility of each of these proteins (PG0495  PG0654  PG1374  PG1795  PG2172  PG0613  PG 1326  PG 1798  PGO 186 and PG0616) on two other /3  gingivalis strains (W83 and ?TCC33277) and on the W50 strain at different growth phases was also evaluated. P.gingivalis strain W50 was grown to early logarithmic  logarithmic  or stationary phase and P.gingivalis strains W83 and ?TCC33277 were grown to stationary phase. Surface accessibility was assessed using the flow cytometry based assay described above.

Figure 6 provides a summary of the results obtained from the various experiments performed with each protein. Each dot (•) set out on the Y axis represents the result obtained in one assay using the applicable protein""s protein-specific antisera. Each horizontal dash (— ) set out along the Y axis represents the average of the results obtained from all experiments performed using a protein""s protein-specific antisera. Each of PG0186  PG0495  PG0613  PG0616  PG0654  PG1326  PG1374  PG1795  PG 1798  and PG2172 were detected as surface exposed on the three P.gingivalis strains. For most proteins  the degree of exposure varied between two or more strains. Antigen exposure also varied during the different growth phases evaluated of the W50 strain (i.e.  early logarithmic  logarithmic  or stationary)  with maximum exposure seen during the logarithmic phase of growth.

Example 6: Assessment of lmmunogenicity of SE protein candidates

A Th2-antibody biased response is associated with protection in the prophylactic alveolar bone loss model (J Immunol. 2008 Sep 15; 181(6):4150-8). In a periodontitis mouse challenge model  immunized mice with a bias toward a ThI response resulted in elevated levels of periodontal tissue inflammation and alveolar bone loss in mice following challenge with P. gingivalis  whereas mice that were biased toward a Th2 response did not develop periodontal bone loss (Am. J. Pathol.

2007; 170:203-213). Murine IgGl has limited Fc-associated effector functions; it binds only to Fc?Rlll and fails to activate complement by the classical pathway (Klaus  1979).

To assess the type of response elicited by the recombinant polypetides  mice (B?LB/c) were immunized intramuscularly with purified recombinant polypeptide (with or without adjuvant).

The immunization protocol used was as follows:

(i) Prebleed samples were taken prior to the commencement of procedure (on day 0).

The first immunization took place on day 7.

(ii) For each purified recombinant protein  2 groups of 8 mice were used. One group was immunized intramuscularly at one site with protein (5 µg) in 0.56 mg/ml adjuvant (i.e. ?lhydrogel ""85"" 2% (aluminum oxyhydroxide))  in a total volume of 50 µl and the second immunized intramuscularly at one site with protein (5 µg) alone (in a total volume of 50 µl).

(iii) ?s controls  mice were immunized with formalin killed whole P. gingivalis W50 cells (FKWC)  prepared substantially as described previously in Rajapakse et al. 2002. One group of 8 mice were immunized with 1010 cfu FKWC alone (in a total volume of 50 µl)  a second group of 8 mice were immunized with 1010 cfu FKWC plus 0.56 mg/ml adjuvant (i.e.  ?lhydrogel ""85"" 2%) in a total volume of 50 µl.

(iv) Sample bleeds were taken from each mouse on day 20.

(v) ? boost was given to mice on day 21 (i.e. a second injection  identical to the first) (vi) Two weeks later  mice were exsanguinated. Sera from each group was not pooled.

Endpoint titers for IgG  IgG l and lgG2a were determined by EL1S? (i.e. by using as a standard the OD observed with a known concentration of FKWC antibodies reacting with FKWC-coated microtitration plates. The lgG l/lgG2a ratio was also determined. The ratio of IgG l to lgG2a is routinely used by persons of skill in the art as an indirect measure of the relative size of the Th2 and ThI components of the immune response. High and low ratios indicate responses dominated by the Th2 and ThI components of the immune response  respectively.

Figure 3 and Table 5 set out the results obtained. FKWC antisera gave high P.gingivalis specific IgG endpoint titer. These EL1S?S  using FKWC-coated microtitration plates  demonstrated that FKWC administered alone (i.e.   without adjuvant) raised a ThI -biased response. Each of the recombinant polypeptides were shown to elicit a P.gingivalis specific Th2-biased antibody response when injected with ?100H  the highest by rPG0495 and rPG2172.

Table 5

Example 6b: Assessment of Antigen-specific immiinogenicity of proteins

The immune response elicited by each of the proteins was assessed in a second study. In this second study  ELlS?s were performed using microtitration plates coated with the individual specific antigens. This allowed for the evaluation of the antigen-specific immunogenicity of each individual protein.

Groups of B?LB/c mice were immunized intramuscularly with purified recombinant polypeptide (with or without adjuvant) in accordance with an immunization protocol substantially as described above. Mice were immunizaed intramuscularly at one site with protein (with either 5 or 25 µg/dose) in 0.56 mg/ml adjuvant (i.e.  ?lhydrogel ""85"" 2%) in a total volume of 50 µl or immunized

intramuscularly at one site with protein alone (with either 5 or 25 µg/dose) in a total volume of 50 µl. Prebleed samples were taken prior to the commencement of the procedure (on day 0) and the first immunization took place on day 7. ?s with the earlier study  a boost was administered on day 21 (i.e.  on day 21   a second injection  identical to the first  was administered) and two weeks later  mice were exsanguinated and serum samples were prepared. For each recombinant polypeptide tested  the number of groups used and the number of mice per group is set out in Table 7 below.

Table 7

Antigen No. of groups Group Adjuvant Dose (µg) No. of mice

PGOl 86 2 #1 : - 5 5

#2: AlOOH 5 15

PG0495 4 #1 : - 5 8

#2: AlOOH 5 8

#3: - 25 5

#4: AlOOH 25 15

PG0613 4 #1 : - 5 8

#2: AlOOH 5 8

#3: - 25 5

#4: AlOOH 25 15

PG0616 2 #1 : - 5 20

#2: AlOOH 5 30

PG0654 4 #1 : - 5 8

#2: AlOOH 5 8

#3: - 25 5

#4: AlOOH 25 15

PG 1326 2 #1 : - 5 5

#2: AlOOH 5 15

PG 1374 4 #1 : - 5 8

#2: AlOOH 5 8

#3: - 25 5

#4: AlOOH 25 15

PG 1795 4 #1 : - 5 8

#2: AlOOH 5 8

#3: - 25 5

#4: AlOOH 25 15

PG 1798 2 #1 : - 5 5

#2: AlOOH 5 15

PG2172 4 #1 : - 5 8

#2: AlOOH 5 8

#3: - 25 5

#4: AlOOH 25 15

Endpoint titers for IgG  IgG l   lgG2a of sera from individual mice were determined by protein-specific EL1S? and the lgG l :lgG2a ratio was calculated. ?n example of an EL1S? protocol utilized is provided here.

Microtiter plates (Nunc-lmmuno MaxiSorp  flat bottom polystyrene) were coated overnight at room temperature (RT) with 100 microl of specific recombinant proteins at 0.5 µg/mL (50 ng/well) in

0.05M Carbonate-Bicarbonate Buffer  pH 9.6. Plates were washed twice with 200µL/well of wash buffer ( IX PBS + 0.1% Tween-20) then blocked for 60 min at RT with 150 µL/well of 1% BS? in PBS.

Two-fold serially diluted serum samples from individual mice were then added and plates were incubated for 60 min at RT. Plates were washed four times with 200microL/well of wash buffer. Hundred microL/well of HRP-conjugated secondary ?bs (F(ab"")2 goat anti-mouse IgG (H+L):HRP diluted at l : 10""000  F(ab"")2 goat anti-mouse IgGl (H+L):HRP diluted at l :20""000  or F(ab"")2 goat anti-mouse lgG2a (H+L):HRP diluted at l :20""000) were then incubated for 60 min at RT. Plates were washed four times with 200microL/well of wash buffer. Hundred microL/well of TMB (HRP substrate) was added to the plates and incubated for 15 min at RT then reaction was stopped by adding 50 microL/well of IM H2SO4. OD values were determined by reading plates on

spectrophotometer wavelength 450nm using prepared templates on SOFTmax Pro v5.2.

The endpoint Titer is defined as the reciprocal of the highest dilution of a serum that gives a reading above the cutoff. The determination of the endpoint titer is based on the cutoff value. To establish the endpoint titer  a cutoff is chosen for every single step and readings of the entire dilution of the entire dilution series are compared with the respective cutoffs. The cutoff OD450 value chosen is 0.100.

The endpoint is reached when a dilution produces a reading lower than or equal to the cutoff. The reciprocal of the previous dilution is reported as the endpoint titer.

? summary of the results obtained are set out in Table 8. ?s shown  each protein was immunogenic at both doses administered (5 and 25 µg) with higher total IgG responses elicited with the higher dose (25 µg). Higher total IgG responses were elicited when the protein was administered in the presence of adjuvant (aluminum hydroxide). Notably  the proteins when adjuvanted elicited a Th2 biased protein specific IgG response. These results show that each of the proteins evaluated are immunogenic and are capable of eliciting the desired Th2 biased protein specific IgG response when appropriated adjuvanted (such as for example with an aluminum compound  e.g.  aluminum hydroxide). Those of skill in the art will appreciate that other adjuvants may be used. Particularly suitable  are those adjuvants which when administered with the proteins of the present invention provide a Th2 biased response.

Table 8

?g-specific IgG endpoint titer (LOGlO)

Antigen Adjuvant Dose (µ; g) IgG" IgGl" lgG2a" Ratio IgG l:lgG2b

PGOl 86 - 5 2.9 ±0.3 2.9 ±0.6 1.7 ±0.0 16.0

AlOOH 5 4.Oi 0.2 4.0 ±0.3 1.7 ±0.0 229.0

PG0495 - 5 2.1 ±0.3 2.2 ±0.5 1.7 ±0.1 - AlOOH 5 5.8 ±0.1 6.0 ±0.3 3.2 ±0.2 624.1

- 25 4.0 ±1.2 4.1 ±1.1 2.8 ±0.7 21.1

AlOOH 25 6.4 ±0.2 6.8 ±0.3 4.2 ±0.4 466.8

PG0613 - 5 2.2 ±0.5 2.2 ±0.6 1.8 ±0.3 - AlOOH 5 4.3 ±0.3 4.7 ±0.3 1.8 ±0.3 789.6

- 25 3.2 ±0.6 3.5 ±0.7 1.7 ±0.1 55.7

AlOOH 25 5.4 ±0.2 5.9 ±0.2 3.2 ±0.9 466.8

PG0616 - 5 3.2 ±0.7 3.3 ± 1.0 2.7 ±0.9 4.0

AlOOH 5 5.2 ±0.6 5.3 ±0.5 3.5 ±0.8 67.7

PG0654 - 5 2.9 ±0.4 3.1 ±0.5 2.4 ±0.7 8.8

AlOOH 5 5.0 ±0.2 5.4 ±0.2 3.8 ±0.0 64.0

- 25 4.6 ±0.4 4.8 ±0.4 3.5 ±0.5 19.0

AlOOH 25 5.5 ±0.3 5.9 ±0.3 3.3 ±0.7 445.7

PG 1326 - 5 5.3 ±0.6 5.2 ±0.5 4.2 ±1.2 16.0

AlOOH 5 6.3 ±0.2 6.3 ±0.2 4.3 ±0.8 111.4

PG 1374 - 5 2.2 ± 0.2 2.3 ±0.5 1.7 ±0.0 4.0

AlOOH 5 5.0 ±0.4 5.2 ±0.2 2.4 ±0.6 673.8

- 25 3.2 ±0.5 3.6 ±0.5 1.8 ±0.3 55.7

AlOOH 25 5.9 ±0.2 6.0 ±0.5 2.9 ±0.4 1123.1

PG 1795 - 5 2.9 ±0.4 2.8 ±0.7 2.0 ±0.3 6.7

AlOOH 5 5.1 ±0.3 5.1 ±0.3 2.2 ±0.6 755.6

- 25 4.9 ±0.6 5.1 ±0.5 3.7 ±1.1 21.2

AlOOH 25 6.3 ±0.2 6.6 ±0.3 4.1 ±0.6 308.0

PG 1798 - 5 3.6 ±0.7 3.6 ±0.4 2.2 ±0.6 23.7

AlOOH 5 4.7 ±0.3 4.8 ±0.2 1.9 ±0.2 891.4

PG2172 - 5 3.2 ±0.8 3.2 ±0.9 2.4 ±0.7 5.9

AlOOH 5 5.0 ±0.2 5.3 ±0.1 2.6 ±0.5 621.1

- 25 5.5 ±0.4 5.1 ±0.4 4.6 ±0.6 4.0

AlOOH 25 6.4 ±0.3 6.6 ±0.2 4.8 ±0.4 57.6 a. Numbers reorese :nt the arithmetic mean ± standard deviation of LOG 10 values derived from the endpoint titers of all the mice for each group

b. The ratio is calculated by dividing the respective initial endpoint titers. Numbers represent the geometric mean of the ratio from all the individual mice per group.

Example 7: Serum Bactericidal Activity

?ntisera generated substantially as described in Example 6 was assessed in two separate studies for serum bactericidal activity (SB?). Such an assay is well known to one skilled in the art. Positive SB? activity of an antigen-specific serum may indicate that the particular antigen would induce a protective immune respond against infection with the corresponding bacteria.

?n example of the method utilized is set out here. In brief  a known quantity of bacterial cells (P. gingivalis) are incubated with control or immune sera  in the presence of active or

inactivated complement. The level of bacterial killing by the serum bactericidal activity is assessed after 1 hour by plating and counting surviving bacteria. Specifically  for each sample and control  214 µL containing approximately 1.26 x 107 cfu of P. gingivalis (strain W50) was aliquoted into a separate well of a sterile microtitre plate  on ice in the anaerobic chamber. For each test sample and control 10 µL of active or inactive complement was aliquoted to separate wells  applicable well 12.52 µL of one of the applicable sera was added and mixed by pipetting (the result was a 20-fold dilution of serum in the SB? reaction). For each sample and control  90 µL of the bacteria + serum mixture was aliquoted to both wells containing active or inactive complement. The contents of each well was mixed by pipetting. Tubes were incubated at room temperature for approximately 60 minutes in an anaerobic chamber.

Dilutions:

For each test sample and control prepared 3 serial 10-fold dilutions were prepared as follows: 20 µL SB? reaction into 180 µL BHl+ Broth  1 serial 6.25-fold dilution 32 µL SB? reaction into 168 µL BHl+ Broth and 3 serial 2.5-fold dilutions 80 µL SB? reaction into 120 µL BHl+ Broth.

Cumulatively  the resultant dilution factors are 10  100  1000  6250  15625  3.90625E4 and

9.765625E4.

Plating:

For each sample and control plated 3 x 10 µL of each of the three highest dilutions were plated onto BHl+ Blood ?gar. This results in a plating factor of 100. Once the inoculated plates were dry  they were inverted and incubated at room temperature in an anaerobic chamber for 4-7 days.

Figure 4 sets out a summary of the SB? results obtained for each recombinant protein  with active or inactive complement. ?t the one dilution of serum tested  PG0495  PG613 and PG 1326 each showed slight bactericidal activity. While the other proteins showed less or no detectable SB? activity  they may induce a protective immune response to infection utilizing a different immune mechanism.

Example 8: Opsonophacocytosis Assay

?n assay was performed to assess the opsonic activity of the polyclonal sera of certain P. gingivalis proteins {i.e. rPG0495  rPG2172  rPG1326  rPG654  rPG1374  rPG1795  rPG0613 and rPG0616). ?ntisera generated substantially as described in Example 6 was assessed. Samples of prebleed sera and of diluent (with no serum) were used as experimental controls.

? bacterial culture of P. gingivalis W50  was grown to approximately 5.0xl0?9 cfu/mL. Cells were pelleted by centrifugation and then washed twice with 1% PBS and labeled with CFSE.

Solution of CFSE prepared by adding IF Buffer to DD?O-SE. Solution was kept in the dark and incubated for 15min at 37C. Samples were wash x 2 with PBS. OP? buffer was then added to samples.

Serum sample was prepared at 1/50 final for opsonization step (final volume 200ul  add 50ul/well) and 1/12.5 dilution in OP? Buffer. Samples were heat inactivated for 30min at 56°C. Inactivated or Active complement was diluted in OP? buffer (1% in final reaction) and then added to samples. On ice the opsonization reaction was started by adding in order Medium  Serum 

Complement and Bacteria. Samples were then incubate at room temperature on a shaking incubator (700vibrations/min) for 30 minutes.

Differentiated HL-60 cell line (?TCC CCL-240) was used as phagocyte. HL-60 cell suspension that have been differentiated for 6 days with DMF 10OmM at a 4x10?5 cell density were harvested  washed in IX HBSS  then resuspend in OP? buffer to 5xlO?6 cell/ml. 200µl of HL-60 cell suspension were added to opsonized bacteria and incubated 30 min at 37°C shaking incubator (700vibrations/min). Opsonophagocytosis was stopped on ice. Samples were kept on ice and acquired on a F?CS Calibur Flow cytometer (Becton Dickison) within 2 hours after the end of the reaction. CSFE Emission signals were collected for each analysis which consisted of 10 000 HL-60 gated events that were collected on the basis of size and granularity using CELLQuest Pro software (Becton Dickinson). Samples were analyzed using the FlowJo7.2.5 software.

The results obtained are summarized in Figure 5. ?t the given dilution tested PG 1374 and PG 0613 each showed slight OP? activity. While the other proteins showed less or no detectable OP? activity  they may induce a protective immune response to infection utilizing a different immune mechanism.

Example 9: Haemagghit inat ion Activity

The ability of antisera raised to certain P. gingival is proteins to inhibit heamagglutination activity (H?1) induced by the bacterium (or bacterial supernate) was assessed. ?nti-haemagglutination activity is a characteristic that has been associated with protective immune serum elicited against a number of pathogens. In some cases  H?1 is a known correlate assay for protection against disease (e.g.  influenza). ?ntisera generated substantially as described in Example 6 were tested for H?1. The method used for assessing haemagglutination activity is described below.

P. gingivalis strains W83 and W50 were grown to stationary phase. Culture samples were centrifuged and the supernatant (media fraction) was separated from the pellet fraction (Whole cells).

The pellets were washed using Dulbecco""s PBS (Gibco) and resuspended to ~1 OD/mL. Sheep""s Red Blood Cells (RBCs) were also washed using Dulbecco""s PBS and the pellet was used to prepare a 1% Sheep""s Blood mix. Supernatant and Pellet (1 OD/mL) samples of each strain were serially diluted 2-fold using Dulbecco""s PBS for a final volume of lOOul per well. lOOul of 1% Sheep""s blood was added to all wells containing sample for a final concentration of 0.5% RBCs. These H? assays were incubated (stationary) at Room Temp or 4°C in aerobic conditions for at least 3 hours. ?t 3 hours  the plates were observed and a well close to the last well with complete H? was chosen for the

Hemagglutination Inhibition Assays.

Sera samples (to test if they can inhibit Hemagglutination of P gingivalis to RBCs) were either purified using the Melon Gel IgG purification kit (Thermo Fisher) or left alone as "crude"  non-purified sera samples.

Sera samples were serially diluted 2-fold in Dulbecco""s PBS. P. gingivalis samples were diluted to the concentration of the chosen well that was close to the last well with complete H? (See above H? ?ssay). 50ul of sera + 50ul of P. gingvalis sample was mixed in a 96- well plate. No antibody control = 50ul of P. gingivalis + Dulbecco""s PBS. Other controls include 50ul sera + 50ul PBS or BHl Media  and lOOul PBS or BHl Media alone. The plate was rocked gently for lhr at 37°C. lOOul of 1% sheep""s blood was added to all wells containing sample for a final concentration of 0.5% Sheep""s RBCs. The plates were incubated (statically) at 4°C  aerobically overnight. (-16-20 hrs) and observed. The H?1 titer was defined by visualizing the most dilute sample of serum which was still able to inhibit the haemagglutination activity of the bacterial pellets or supernate. For significance  the H?1 titer of an immune serum should be at least >2 times the H?1 titer of the pre-bleed serum samples. The H?1 titers are shown in Table 9.

Table 9

The H?I titers noted with the symbol "*" were 2 times the pre-bleed background. This indicates that antibodies to these antigens inhibit H? activity of P. gingival is.

Example 10: The efficacy of recombinant proteins to protect against challenge with P. gingival is

The protective efficacy of each purified protein  alone or in combination is evaluated in a well established prophylactic murine periodontal bone loss model  described previously (5). In studies using such a model  a Th2-biased response (with associated changes in IgG subclass distribution) has been shown to correlate with protection against P. gingivalis induced bone loss. Mice (B?LB/c  6-8 week old) are immunized s.c. with each recombinant protein (10 50 µg/dose) or with a combination of purified recombinant proteins (10 50 µg/dose/protein) selected from the group consisting of PG0186  PG0495  PG0613  PG0616  PG0654  PG1326  PG 1374  PG1795  PG1798  and PG2172 in the presence and absence of various adjuvants that provide the appropriate Th2-biased response (such as for example  aluminum hydroxide or ?lhydrogel) to assess protection against a challenge with P. gingivalis. The recombinant protein or proteins are derived from P. gingivalis strain W50 (or W83)  by known methods  such as for example  as described in Example 2. One to 3 booster doses can be administered at 1-2 week intervals (or at longer intervals) and mice are bleed about 12 days later from the retrobulbar plexus. After bleeding  mice receive kanamycin at 1 mg/ml in deionized water ad libitum for 7 days. Three days after antibiotic treatment  mice are orally challenged  2 days apart with 1 x 1010 viable P. gingivalis strain W50 cells and a control group is sham-infected with PG buffer containing 2 g/100 ml carboxymethylcellulose alone (as described previously (5)). The mice are sacrificied 28 days following challenge and maxillae are removed and prepared. Horizontal bone loss is assessed as previously described (5). Sera is collected and antibody titers are measured by EL1S?.

While the present invention has been described in terms of the preferred embodiments  it is understood that variations and modifications for example to the compounds  compositions and methods described herein will occur to those skilled in the art. Therefore  it is intended that the appended claims cover all such equivalent variations that come within the scope of the invention as claimed.

REFERENCES

The content of the following are incorporated by reference in their entirety:

1. L. Frazer  et al.  "Vaccination with recombinant adhesins from the Rgp?-Kgp proteinase- adhesin complex protects against Porphyromonas gingivalis infection " 24 (42-43)  6542 (2006)

2. N. M. O""Brien-Simpson  et al.  "Serum immunoglobulin G (IgG) and IgG subclass responses to the Rgp?-Kgp proteinase-ashesin complex of Porphyromonas gingivalis in adult periodontitis 68(5) 2704 (2000)

3. N. M. O""Brien-Simpson  et al.  "Role of Rgp?  RgpB and Kgp proteinases in virulence of Porphyromonas gingivalis W50 in a murine lesion model " 69( 12)  7527 (2001).

4. N. M. O""Brien-Simpson et al  "Rgp?-Kgp peptide-based immunogens provide protection against Porphyromonas gingivalis challenge in a murine lesion model " 68(7)  4055 (2000)

5. N. M O""Brien-Simpson  et al  "?n immune response directed to proteinase and adhesin

functional epiptopes protects against Porphyromonas gingivalis-induced periotontal bone lone  " 175(6)  3980 (2005)

6. N. M. O""Brien-Simpson et al.  "Porphyromonas gingivalis Rgp?-Kgp proteinase-adhesin complexes penetrate gingival tissue and induce pro-inflammatory cytokines or apoptosis in a concentration-dependant manner"  (2008)

7. N. M. O""Brien-Simpson et al.  "Antigens of bacteria associated with periodontitis"  35  101(2004)

8. V.Tam et al.  "Characterization of T Cell Responses to the Rgp?-Kgp Proteinase-?dhesin Complexes of Porphyromonas gingivalis in B?LB/c Mice " 181(6)  4150 (2008)

9. Booth V et al.  Passive immunization with monoclonal antibodies against Porphyromonas gingivalis in patients with periodontitis. Infect Immun. 1996 Feb;64(2):422-7

10. Yokoyama  Effects of egg yolk antibody against P. gingivalis gingipains in periodontitis patients. J Oral Sci. 2007 Sep;49(3):201-6

1 1. Holt SC  Kesavalu L  Viriulence factors of P gingivalis. Periodontal 2000.1999 Jun 20: 168- 238

12. Nelson KE  et al  complete genome sequence of the oral pathogenic bacterium P. gingivalis strain W83. J. Bacteriol. 2003 Sep; 185( 18):5591-601

13. "Determination of the Genome Sequence of Porphyromonas gingivalis Strain ?TCC 33277 and Genomic Comparison with Strain W83 Revealed Extensive Genome Rearrangements in P. gingivalis"  DN? Res. 2008 August; 15(4): 215 225.
CLAIMS

1. ?n immunogenic composition comprising at least one isolated polypeptide and a

pharmaceutically acceptable carrier  wherein the at least one polypeptide is selected from the group consisting of:

a. P. gingival is protein PG0495  or an immunogenic fragment or variant thereof; b. P.gingivalis protein PG0654  or an immunogenic fragment or variant thereof c. P. gingivalis protein PG 1374  or an immunogenic fragment or variant thereof d. P. gingivalis protein PG 1795  or an immunogenic fragment or variant thereof e. P. gingivalis protein PG0613  or an immunogenic fragment or variant thereof f. P. gingivalis protein PG2172  or an immunogenic fragment or variant thereof g. P. gingivalis protein PG 1326  or an immunogenic fragment or variant thereof h. P. gingivalis protein PG 1798  or an immunogenic fragment or variant thereof i. P. gingivalis protein PGO 186  or an immunogenic fragment or variant thereof; and j. P. gingivalis protein PG0616  or an immunogenic fragment or variant thereof.

2. ?n immunogenic composition comprising at least one isolated polypeptide and a

pharmaceutically acceptable carrier  wherein the at least one polypeptide is selected from the group consisting of:

a. a polypeptide having at least 80% identity to SEQ ID NO: 1;

b. a polypeptide having at least 80% identity to SEQ ID NO:3;

c. a polypeptide having at least 80% identity to SEQ ID NO:5;

d. a polypeptide having at least 80% identity to SEQ ID NO:7;

e. a polypeptide having at least 80% identity to SEQ ID NO:9;

f. a polypeptide having at least 80% identity to SEQ ID NO: 1 1 ;

g. a polypeptide having at least 80% identity to SEQ ID NO: 13;

h. a polypeptide having at least 80% identity to SEQ ID NO: 15;

i. a polypeptide having at least 80% identity to SEQ ID NO: 17; and

j. a polypeptide having at least 80% identity to SEQ ID NO: 19.

3. ? composition according to claims 1 or 2  wherein the composition further comprises an adjuvant.

4. ? method of treating or preventing a P. gingivalis infection in a subject comprising

administering to the subject a therapeutically effective amount of a composition according to claims 1 or 2.

5. ? method of treating or preventing a P. gingivalis infection in a subject comprising

administering to the subject a therapeutically effective amount of a composition according to claim 3.

6. ? method of inducing an immune response in a subject  the method comprising the step of administering to the subject a composition according to claims 1 or 2.

7. The use of an isolated polypeptide in an immunogenic composition for the prevention or treatment of a P. gingivalis infection  wherein the isolated polypeptide is selected from the group consisting of:

a. P. gingivalis protein PG0495  or an immunogenic fragment or variant thereof; b. P. gingivalis protein PG0654  or an immunogenic fragment or variant thereof c. P. gingivalis protein PG 1374  or an immunogenic fragment or variant thereof d. P. gingivalis protein PG 1795  or an immunogenic fragment or variant thereof e. P. gingivalis protein PG0613  or an immunogenic fragment or variant thereof f. P. gingivalis protein PG2172  or an immunogenic fragment or variant thereof g. P. gingivalis protein PG 1326  or an immunogenic fragment or variant thereof h. P. gingivalis protein PG 1798  or an immunogenic fragment or variant thereof i. P. gingivalis protein PGO 186  or an immunogenic fragment or variant thereof; and j. P. gingivalis protein PG0616  or an immunogenic fragment or variant thereof.

8. The use of an isolated polypeptide in an immunogenic composition for the prevention or treatment of a P. gingivalis infection  wherein the isolated polypeptide is selected from the group consisting of:

a. a polypeptide having at least 80% identity to SEQ ID NO: 1 ;

b. a polypeptide having at least 80% identity to SEQ ID NO:3;

c. a polypeptide having at least 80% identity to SEQ ID NO:5;

d. a polypeptide having at least 80% identity to SEQ ID NO:7;

e. a polypeptide having at least 80% identity to SEQ ID NO:9;

f. a polypeptide having at least 80% identity to SEQ ID NO: 1 1 ;

g. a polypeptide having at least 80% identity to SEQ ID NO: 13;

h. a polypeptide having at least 80% identity to SEQ ID NO: 15;

i. a polypeptide having at least 80% identity to SEQ ID NO: 17; and

j. a polypeptide having at least 80% identity to SEQ ID NO: 19.

9. ? method of treating or preventing a P. gingivalis infection in a subject comprising

administering to the subject a therapeutically effective amount of a composition comprising at least one isolated nucleic acid wherein the isolated nucleic acid is selected from the group consisting of:

a. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO: 1; b. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO:3; c. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO:5; d. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO:7; e. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO:9; f. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO: 1 1; g. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO: 13; h. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO: 15; i. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO: 17; and

j. a nucleic acid encoding a polypeptide having at least 80% identity to SEQ ID NO: 19.

10. The method of claim 9 wherein the composition further comprises an adjuvant.

1 1. ?n antibody that binds specifically to a polypeptide  wherein the polypeptide is selected from the group consisting of:

a. P. gingivalis protein PG0495  or an immunogenic fragment or variant thereof;

b. P. gingivalis protein PG0654  or an immunogenic fragment or variant thereof c. P. gingivalis protein PG 1374  or an immunogenic fragment or variant thereof d. P. gingivalis protein PG 1795  or an immunogenic fragment or variant thereof e. P. gingivalis protein PG0613  or an immunogenic fragment or variant thereof f. P. gingivalis protein PG2172  or an immunogenic fragment or variant thereof g. P. gingivalis protein PG 1326  or an immunogenic fragment or variant thereof h. P. gingivalis protein PG 1798  or an immunogenic fragment or variant thereof i. P. gingivalis protein PGO 186  or an immunogenic fragment or variant thereof; and j. P. gingivalis protein PG0616  or an immunogenic fragment or variant thereof.

12. ?n antibody that binds specifically to a polypeptide  wherein the polypeptide is selected from the group consisting of:

a. a polypeptide having at least 80% identity to SEQ ID NO: 1;

b. a polypeptide having at least 80% identity to SEQ ID NO:3;

c. a polypeptide having at least 80% identity to SEQ ID NO:5;

d. a polypeptide having at least 80% identity to SEQ ID NO:7;

e. a polypeptide having at least 80% identity to SEQ ID NO:9;

f. a polypeptide having at least 80% identity to SEQ ID NO: 1 1 ;

g. a polypeptide having at least 80% identity to SEQ ID NO: 13;

h. a polypeptide having at least 80% identity to SEQ ID NO: 15;

i. a polypeptide having at least 80% identity to SEQ ID NO: 17; and

j. a polypeptide having at least 80% identity to SEQ ID NO: 19.

13. ? method of treating a subject by administering to the subject the antibody of claim 1 1.

14. ? method of treating a subject by administering to the subject the antibody of claim 12.

15. ? method of treating a P. gingivalis infection in a subject comprising administering to the subject the antibody of claim 1 1.

16. ? method of treating a P. gingivalis infection in a subject comprsing administering to the subject the antibody of claim 12.

17. ? kit for detecting the presence of a P. gingivalis infection in a subject comprising at least one isolated polypeptide  wherein the polypeptide is selected from the group consisting of: a. P. gingivalis protein PG0495  or an immunogenic fragment or variant thereof; b. P. gingivalis protein PG0654  or an immunogenic fragment or variant thereof c. P. gingivalis protein PG 1374  or an immunogenic fragment or variant thereof d. P. gingivalis protein PG 1795  or an immunogenic fragment or variant thereof e. P. gingivalis protein PG0613  or an immunogenic fragment or variant thereof f. P. gingivalis protein PG2172  or an immunogenic fragment or variant thereof g. P. gingivalis protein PG 1326  or an immunogenic fragment or variant thereof h. P. gingivalis protein PG 1798  or an immunogenic fragment or variant thereof i. P. gingivalis protein PGO 186  or an immunogenic fragment or variant thereof; and j. P. gingivalis protein PG0616  or an immunogenic fragment or variant thereof.

18. ? kit for detecting the presence of a P. gingivalis infection in a subject comprising at least one isolated polypeptide  wherein the polypeptide is selected from the group consisting of: a. a polypeptide having at least 80% identity to SEQ ID NO: 1 ;

b. a polypeptide having at least 80% identity to SEQ ID NO:3;

c. a polypeptide having at least 80% identity to SEQ ID NO:5;

d. a polypeptide having at least 80% identity to SEQ ID NO:7;

e. a polypeptide having at least 80% identity to SEQ ID NO:9;

f. a polypeptide having at least 80% identity to SEQ ID NO: 1 1 ;

g. a polypeptide having at least 80% identity to SEQ ID NO: 13;

h. a polypeptide having at least 80% identity to SEQ ID NO: 15;

i. a polypeptide having at least 80% identity to SEQ ID NO: 17; and

j. a polypeptide having at least 80% identity to SEQ ID NO: 19.

19. ? method of reducing the risk of a P. gingivalis infection in a subject  the method

comprising the step of administering to the subject a therapeutically effective amount of a composition according to claims 1 or 2.

20. ? method according to claims 4 or 5  wherein the subject is at risk of developing or has a symptomatic P. gingivalis infection.

21. ? method according to claim 20  wherein the subject has a symptomatic P. gingivalis infection.

Abstract
Provided herein are compositions and methods for eliciting an immune response against Porphyromonas gingivalis. The compositions and methods relate to P. gingivalis polypeptides and fragments and variants thereof and the corresponding polynucleotides which are useful in the diagnosis  prevention and therapy of P. gingivalis infections (e.g. periodontitis). Antibodies against the polypeptides and compositions and methods including these antibodies are also disclosed. The disclosure also describes methods for the detection  prevention and treatment of P. gingivalis infection (e.g. periodontitis).

Documents

Application Documents

# Name Date
1 Power of Authority.pdf 2012-02-04
2 Form-5.pdf 2012-02-04
3 Form-3.pdf 2012-02-04
4 Form-1.pdf 2012-02-04
5 Drawings.JPG 2012-02-04
6 1017-CHENP-2012 FORM-1 20-07-2012.pdf 2012-07-20
7 1017-CHENP-2012 CORRESPONDENCE OTHERS 20-07-2012.pdf 2012-07-20
8 1017-CHENP-2012 FORM-3 25-07-2012.pdf 2012-07-25
9 1017-CHENP-2012 CORRESPONDENCE OTHERS 25-07-2012.pdf 2012-07-25
10 1017-CHENP-2012 CORRESPONDENCE OTHERS 03-12-2012.pdf 2012-12-03
11 1017-CHENP-2012 FORM-18 23-07-2013.pdf 2013-07-23
12 1017-CHENP-2012 FORM-13 23-07-2013.pdf 2013-07-23
13 1017-CHENP-2012 CORRESPONDENCE OTHERS 23-07-2013.pdf 2013-07-23
14 1017-CHENP-2012 AMENDED CLAIMS 23-07-2013.pdf 2013-07-23
15 1017-CHENP-2012-FER.pdf 2017-12-11
16 1017-CHENP-2012-AbandonedLetter.pdf 2018-07-10

Search Strategy

1 1017_08-12-2017.pdf