Abstract: The disclosure relates to a process of obtaining a fully folded two chain insulin glargine that require no further processing to make it functionally active. The present disclosure discloses a surprising effect of over expression of Kex2p intracellularly under the control of inducible FLD1 promoter in the host Pichia pastoris to produce two chain functional glargine secreted directly in the medium. The schematic digram of how the two chains are made inside the host Pichia pastoris and secretes into the medium. Fig 18
TECHNICAL FIELD
The disclosure relates to a method of obtaining biologically active functional insulin glargine into the culture medium without the use of the proteolytic enzyme trypsin in the downstream process. More specifically the disclosure relates to designing an expression system by co-expressing Kex2p using FLD1 promoter in Pichia pastoris to produce functional two chain glargine into the medium to enable processing of the insulin glargine into active two chain fully folded form invivo.
BACKGROUND AND PRIOR ART
Recombinant forms of glargine have been produced in various microbial expression systems wherein organisms such as E.coli Saccharomyces cerevisiae have been employed for the commercial production of recombinant human insulin and derivatives thereof. Owing to certain disadvantages of these systems such as low expression levels difficulties in downstream purification etc. the use of methylotrophic yeast Pichia pastoris (P.pastoris) has been favored as a protein expression system. The expression system offers several advantages such as high expression simple processing low production cost high density culture (US6800606).
Insulin Glargine is a slow acting insulin analogue. Use of E.coli as an expression system for the expression is already there in the prior art. As E.coli does not have the cellular machinery for folding the expressed polypeptide and establish the disulphide bridges correctly so there is a need in the art to overcome such folding problem.
The glargine downstream process involves the clipping of the precursor using trypsin. Trypsin has the specificity of clipping at the carboxyl terminal of both ‘K” and ‘R’ (as shown in fig: 1). This results in the generation of more product related impurities (as shown in fig: 1)
1) FVNQHLCGSHLVEALYLVCGER
2) FVNQHLCGSHLVEALYLVCGERGFFYTPK
3) FVNQHLCGSHLVEALYLVCGERGFFYTPKTR
4) GFFYTPKTR
5) TRR
The disadvantages associated with the known downstream processes of the prior art have been remedied in the instant disclosure.
US4929553 and its related applications are concerned with the specific processing of secreted proteins in genetically modified yeast cells. Specifically this disclosure is concerned with the use of recombina nt DNA to produce Kex2 in greater quantities. The expression of proteins and use of Kex2p to processes after the cleave after dibasic amino acid is known in the prior art.
WO2008037735 and its related applications disclosed a method for making mature human insulin or an analogue wherein C-terminal amino acid residue in the B-chain cleaved off by means of a carboxypeptidase activity either within the fungi cell or subsequently in the culture medium.
Hence there exists a need in the art to produce a process of producing a functional two chain glargine into the medium to enable processing of the insulin glargine into active two chain fully folded form invivo.
STATEMENT OF DISCLOSURE
Accordingly the present disclosure relates to a process of expressing a fully folded functional two chain insulin glargine that require no further processing to make it functionally active said process comprising steps of i) cloning a glargine pro-peptide and a protease in Pichia pastoris; wherein the sequence coding for protease is put under the control of a constitutive or inducible promoter ii) co-expressing the said pro-peptide and the protease and iii) obtaining a fully functional insulin glargine; a process of converting pro insulin glargine into fully folded biologically active insulin glargine said method comprising steps of i) obtaining a host cell comprising a nucleotide sequence encoding pro insulin glargine ii) co-expressing Kex2p under the control of FLD1 promoter within the host cell to convert the pro-peptide glargine into a fully folded biologically active insulin glargine.
BRIEF DESCRIPTION OF ACCOMPANYING DRAWINGS:
The features of the present disclosure will become more fully apparent from the following description taken in conjunction with the accompanying drawings. Understanding that the drawings depict only several embodiments in accordance with the disclosure and are therefore not to be considered limiting of its scope the disclosure will be described with additional specificity and detail through use of the accompanying drawings:
Figure 1 illustrates the single chain glargine precursor secreting into the medium with black downward arrows showing the trypsin cleavage sites.
Figure 2 illustrates Vector map of Fglargine/pPIC9K.
Figure 3 illustrates the secretion of a single chain of Fglargine using endogenous Kex2p protease. Fglargine #1/GS115 was selected for all the future studies.
Figure 4 illustrates mass results of F-glargine in GS115 without kex2p. Only precursor F-glargine is seen.
Figure 5 illustrates and represents the single chain glargine sequence with Kex2p cleavage sites. The protease cleaves after dibasic amino acids and secretes the two chain glargine into the medium. This will not generate any other impurities.
Figure 6 illustrates the vector map of ?Kex2p/pGAP under the control of GAP promoter intracellulary.
Figure 7 illustrates the representative picture showing the resistance to Zeocin. The colonies were picked up grown in YPD broth and stamped onto YPD plates containing 0.5 mg/ml Zeocin.
Figure 8 illustrates that the clones were induced with methanol and secreted supernatant was analyzed using tricine SDS PAGE
Figure 9 illustrates the typical HPLC profile showing F-glargine#1 without kex2?p660. Only precursor glargine peak obtained.
Figure 10 illustrates the typical HPLC profile showing F-glargine expression profile with co-expression of kex2?p660 under the control of constitutive GAP promoter. Precursor glargine peak appears at RT ~9.6 to 10 mins and processed glargine peak appears at 11.6 to 12 mins.
Figure 11 illustrates the following:
A) Showing the PCR fragments amplified in separate tubes. Left side is FLD1 promoter right side Kex2p fragment and the middle lane is the ?DNA EcoRI/Hind3 marker.
B) Fused PCR product run on 1% agarose gel.
C) Restriction analysis of FLD1-?Kex2p/pTZ57R
Figure 12 illustrates the vector map showing features of FLD1-Kex2p/pPICZA
Figure 13 illustrates the restriction analysis of FLD1-Kex2p/pPICZA: Lane1 = Digestion with Pst1/EcoRV (linearizes) Lane 2 = Digestion with Nde1(Expected 639bp 956bp 3407bp) Lane3 = Digestion with BstB1 and Sac1(Expected 511bp 4448bp).
Figure 14 illustrates the screening of s about 20 clones to confirm the integration. All clones except clone#1 6 9 and 13 are given expected PCR amplicon. LaneP is positive control where plasmid was used as a template. Lane 9582 is a negative control (parent strain) and lane M is DNA molecular weight marker
Figure 15 illustrates the typical HPLC profile showing the precursor peak and the two chain glargine peaks. The picture indicated that the conversion is about 90%.
Figure 16 illustrates HPLC profile of Glargine purified product (2 chain).
Figure 17 illustrates HPLC profile of 2 chain Glargine secreted from Kex2 over-expressed clone (FLD-Kex2p).
Figure 18 illustrates the schematic diagram of how the two chains are made inside the host Pichia pastoris and secreted into the medium.
Table1 shows the percentage conversion of two chain glargine with co-expression of ?Kex2p under the control of GAP promoter.
Table 2 shows the percentage conversion of two chain glargine with co-expression of ?Kex2p under the control of FLD1 promoter.
DETAILED DESCRIPTION OF DISCLOSURE:
The present disclosure is in relation to a process of expressing a fully folded functional two chain insulin glargine that require no further processing to make it functionally active said process comprising steps of i) cloning a glargine pro-peptide and a protease in Pichia pastoris wherein the sequence coding for protease is put under the control of a constitutive or inducible promoter ii) co-expressing the said pro-peptide and the protease and iii) obtaining a fully functional insulin glargine.
In an embodiment of the present disclosure the yield of the fully folded biologically active insulin glargine obtained by the said method is more than 93%.
In still another embodiment of the present disclosure the glargine pro-peptide is set forth as SEQ ID No. 1.
In still another embodiment of the present disclosure the glargine pro-peptide is set forth as SEQ ID No. 1.
In still another embodiment of the present disclosure the protease is Kexin endoprotease (Kex2p) set forth as SEQ ID No. 2
In still another embodiment of the present disclosure the constitutive promoter is a GAP promoter.
In still another embodiment of the present disclosure the inducible promoter is a FLD1 promoter.
In still another embodiment of the present disclosure the constitutive promoter GAP enables the over expression of Kex2p of SEQ ID No. 2 at levels wherein the protease cleaves the pro-peptide of SEQ ID No. 1 to secrete up to 75% of insulin glargine as a fully folded and functional two chain peptide that requires no further processing to make it active.
In still another embodiment of the present disclosure the inducible promoter FLD1 enables the over expression of Kex2p of SEQ ID No. 2 at levels wherein the protease cleaves the pro-peptide of SEQ ID No. 1 to secrete up to 100% of insulin glargine as a fully folded and functional two chain peptide that requires no further processing to make it active.
The present disclosure also relates to a process of converting pro insulin glargine into fully folded biologically active insulin glargine said method comprising steps of obtaining a host cell comprising a nucleotide sequence encoding pro insulin glargine and co-expressing Kex2p under the control of FLD1 promoter within the host cell to convert the pro-peptide glargine into a fully folded biologically active insulin glargine.
The present disclosure overcomes the disadvantages associated with the known downstream processes of the prior art have been remedied by over expressing the Kex2p in Pichia pastoris to produce two chain functional glargine directly in the medium to avoid the impurities formed due to the Trypsin. The instant disclosure relates to designing an expression system by the co-expressing of Kex2p and FLD1 promoter in Pichia pastoris to produce functional glargine into the medium without the use of trypsin.
In another embodiment the instant disclosure also provides us with the solution to overcome the downstream impurities formed due to the use of serine protease enzyme trypsin by secreting the functional glargine directly in the medium by the over expressing Kex2p intracellularly under the influence of FLD1 promoter. The surprising results of this method is not disclosed in any of the prior art.
However the present disclosure discloses a process of producing a functional two chain glargine into the medium to enable processing of the insulin glargine into active two chain fully folded form invivo. The surprising effect is due to the over expression of Kex2 in the host cell in presence of FLD1 promoter.
The purpose of the present disclosure is to develop a process of obtaining a fully folded two chain insulin glargine that require no further processing to make it functionally active.
The main objective of the present disclosure is to obtain a fully folded two chain insulin glargine that require no further processing to make it functionally active.
Yet another objective of the present disclosure is to obtain the insulin glargine by co-expressing a pro-peptide of SEQ ID No. 1 and Kex2p in Pichia pastoris.
Still another object of the present disclosure is to provide over expressed Kex2p under the control of inducible FLD1 promoter wherein the inducible promoter FLD1 enables over expression of Kex2p of SEQ ID No. 2 at levels wherein the protease cleaves the pro-peptide to secrete up to 100% of insulin glargine as a fully folded and functional two chain peptide that requires no further processing in the medium.
The present disclosure relates to process of obtaining a fully folded two chain insulin glargine that require no further processing to make it functionally active. The said process comprising steps of:
i) Constructing the insulin Glargine producing clone in Pichia pastoris;
ii) Synthesis of Insulin glargine (here after Fglargine) coding sequence;
iii) Transformation of Pichia pastoris;
iv) Co-expression of FLD1 promoter driven ?Kex2p intracellularly; and
v) Transformation and screening of clones for two chain glargine secretion.
In yet another objective of the present disclosure the insulin glargine is afforded by co-expressing a pro-peptide of SEQ ID No. 1 and Kex2p in Pichia pastoris.
Still another object of the present disclosure the Kex2p is over expressed under the control of inducible FLD1 promoter.
In another object of the present disclosure the inducible promoter FLD1 enables over expression of Kex2p at levels wherein the protease cleaves the pro-peptide to secrete up to 100% of insulin glargine as a fully folded and functional two chain peptide that requires no further processing in the medium.
As used herein “insulin analogue” is an insulin molecule having one or more mutations substitutions deletions and/or additions of the A and/or B amino acid chains relative to the native human insulin molecule. More specifically one or more of the amino acid residues may have been exchanged with another amino acid residue and/or one or more amino acid residue may have been deleted and/or one or two amino acid residues may have been added with the provision that said insulin analog has a sufficient insulin activity. The insulin analogs are preferably such wherein one or more of the naturally occurring amino acid residues preferably one two or three of them have been substituted by another codable amino acid residue. Examples of insulin analogues are described in the following patents and equivalents thereto: US 5 618 913 EP 254 516 EP 280 534 US 5 750 497 and US 6 011 007. Examples of specific insulin analogues are insulin aspart (i.e. AspB28 human insulin) and insulin lispro (i.e. LysB28 ProB29 human insulin) and "insulin glargine" (Lys B(3) GIu B(29) human insulin.
Trypsin is a typical serine protease and hydrolyzes a protein or a peptide at the carboxyl terminal of an arginine or lysine residue (Enzymes pp 261 -262(1979) ed. Dixon M. & Webb E. C Longman Group Ltd. London). In particular facile hydrolysis occurs at a dibasic site where two successive arginine or lysine residues exist and it is known that hydrolysis occurs most readily where the dibasic site is located in or next to a ß-turn structure (Rholam M. et al. FEBS Lett. 207 I-6(1986).The Enzyme Vol. II 3rd Edition Editor Boyer Acad. Press NY. Pp. 249-275). Particularly trypsin cleaves peptide bonds at C-terminal arginine (Arg) or lysine (Lys) residues. Tryptic cleavage of insulin precursor molecules can occur at different cleavage sites simultaneously. Because of the many cleavage sites within a specific insulin precursor molecule many undesired side-products can be formed during tryptic cleavage reaction.
The present disclosure provides vectors comprising DNA encoding any of the herein described genes. Host cell comprising any such vectors are also provided. By way of example the host cells may be bacterial fungal or mammalian.
The present disclosure employs a recombinant host cell in which at least a portion of a nucleic acid sequence expressing the insulin compound precursor is produced. A recombinant expression system is selected from prokaryotic and eukaryotic hosts. Eukaryotic hosts include yeast cells (e.g. Saccharomyces cerevisiae or Pichia pastoris) mammalian cells or plant cells. Bacterial and eukaryotic cells are available from a number of different sources including commercial sources to those skilled in the art e.g. the American Type Culture Collection (ATCC; Rockville Md.). Commercial sources of cells used for recombinant protein expression also provide instructions for usage of the cells. The choice of the expression system depends on the features desired for the expressed polypeptide.
Most preferably related to aspects of the present disclosure the most preferred host cells are methylotrophic yeasts. Strains of a methylotrophic yeast which can be modified using the present disclosure include but are not limited to yeast strains capable of growing on methanol such as yeasts of the genera Pichia Candida Hansenula or Torulopsis. Preferred methylotrophic yeasts are of the genus Pichia. Methylotrophic yeast strains which can be modified using the present methods also include those methylotrophic yeast strains which have been engineered to express one or more heterologous proteins of interest.
The term “promoter” is used in the normal sense of the art e.g. an RNA polymerase binding site.
The term “vector” includes expression vectors replicable vectors transformation vectors and shuttle vectors including vector combinations thereof.
The term “expression vector” means a construct capable of in-vivo or in-vitro expression.
Preferably the expression vector is incorporated in the genome of the organism. The term “incorporated” preferably covers stable incorporation into the genome.
In molecular biology transformation is the genetic alteration of a cell resulting from the direct uptake incorporation and expression of exogenous genetic material (exogenous DNA) from its surroundings and taken up through the cell membrane(s).
The host cell or organism can be engineered to express recombinant protein or peptide using standard techniques. For example recombinant protein can be expressed from a vector or from an exogenous gene inserted into the genome of the host.
The expression of the gene encoding the two chain insulin glargine is controlled by a promoter (e.g. an inducible promoter or a constitutive promoter). Preferably the promoter is a strong promoter more preferably a strong inducible promoter which allows for the production of large quantities of the desired product. The cells transformed with the gene may be fungal. For expression in Pichia pastoris the promoter used to drive the expression of the gene is preferably the GAP promoter (a strong constitutive promoter) or the AOXl or AOX2 promoter (a strong inducible promoter) and the strong FLD1.
Vectors that can be used to express proteins are well known in the art and are described below. Preferred vectors of the present disclosure carrying insulin precursor molecule genes include but are not limited to FLD1-Kex2p/pPICZA.
As used herein the term "expression" refers to a process by which a polypeptide is produced based on the nucleic acid sequence of a gene. The process includes both transcription and translation.
As used herein the term "primer" refers to an oligonucleotide whether occurring naturally as in a purified restriction digests or produced synthetically which is capable of acting as a point of Initiation of synthesis when placed under conditions in which synthesis of a primer extension product which is complementary to a nucleic acid strand is induced (i.e. in the presence of nucleotides and an inducing agent such as DNA polymerase and at a suitable temperature and pH).
Example 1:
Protocols adapted to produce two chain Insulin glargine in Pichia pastoris.
1.1 Constructing the insulin Glargine producing clone in Pichia pastoris.
Insulin glargine (here after Fglargine) sequence (SEQ ID No. 1) without the leader sequence is cloned into the Pichia expression vector and transformed in Pichia pastoris.
Amino acid sequence of the Fglargine sequence SEQ ID No. 1 is as follows:
FVNQHLCGSHLVEALYLVCGERGFFYTPKTRRGIVEQCCTSICSLYQLENYCG
1.2 Synthesis of Fglargine coding sequence:
The Fglargine coding sequence was codon optimized for expression in Pichia pastoris and obtained the synthetic cDNA from Geneart AG Germany. The desired fragment was amplified with the primers designed specific to the gene and cloned into pTZ57RT vector (Fermentas) and sequence verified. After the sequence integrity was verified the synthetic Fglargine coding sequence was subcloned into the Pichia expression vector in XhoI/EcoRI sites to give Fglargine/pPIC9K (pPIC9K is a plasmid). This cloning step fused the Fglargine coding sequence to the Mat-a signal sequence for secretion and placed it under the control of AOX1 promoter and terminator(as shown in Figure 2 and SEQ ID No. 1).
Example: 2
Transformation of Pichia pastoris:
The construct Fglargine/pPIC9K was transformed by electroporation into Pichia pastoris and selected His? phenotypes. Transformation was done by electroporation of freshly grown cells in 0.2 cm cuvettes. The pulse was delivered by Gene Pulser (BioRad) at 1500 V 25 µF and 200 O. The electroporated cells were allowed to recover for 1 hour in 1 M sorbitol at 30°C and then the transformation mix is spread onto YNBD agar plates. 1200 transformants were screened for integration of multiple copies of Fglargine constructs in the genome by their resistance to successively higher concentrations of G418 (aminoglycoside antibiotic Geneticin). Standard protocols recommended by the manufacturer (Invitrogen Inc.) were followed for screening and expression. The clones chosen on this basis were taken up for expression studies. Fglargine #1/GS115 (selected from the list of 1200 transformants disclosed above) was selected for all the future studies. The productivity of single chain precursor was checked in the shake flask study (Figure 3) and only precursor Fglargine will be seen without Kex2p (as shown in Figure 4).
Pichia pastoris GS115 is a His- host. It cannot grow in minimal media without amino acid Histidine supplemented. The vector pPIC9K has the His 4 gene. When the vector is transformed to GS115 host the host becomes His+. It can grow on minimal media. This is also explained in the Pichia expression manual (Invitrogen).
Example: 3
Co-expression of Kex2p under the control of GAP promoter:
From Figure 4 it is well understood that it is not possible to secrete two chain glargine directly into the medium using endogenous Kex2p alone. Hence attempt to co-express the Kex2p with GAP promoter to increase the protease level endogenously has been taken.
Example: 4
Construction of a single copy ?Kex2p under GAP promoter:
The Kexin endoprotease (Kex2p) is 777 amino acid membranes bound protein. It is very difficult to produce this enzyme by means of recombinant technology. This has the substrate specificity to cleave after di-basic amino acids like RR KR KK and RK. The most preferred among the four are KR and RR and it barely clips after RK and KK (see Figure 5). From the prior art as disclosed in EP0794254A2 only the 660 amino acid cytosolic domain in S.cerevisiae is sufficient for the activity. Similarly in the present disclosure Kex2p functional domain of 660 amino acid from the Pichia was selected for expression in Pichia pastoris. PCR amplification of the gene is carried out corresponding to this functional domain using Pichia pastoris genomic DNA as template. The plasmid construct was developed by cloning the 660 amino acid kex2p CDS (here after ?Kex2p) in-frame with GAP promoter without Mata signal peptide for intracellular expression as shown in Figure 6 and SEQ ID No. 2.
Example: 5
Transformation and shake flask expression studies:
• The plasmid ?Kex2p/pGAP is transformed into Fglargine #1/GS115 host using standard protocol. The transformants obtained were screened for Zeocin resistance at the concentration of 0.5mg/ml(as shown in Figure 7). Based on the good growth on Zeocin containg plates following clones were analyzed for the two chain glargine secretion (as shown in Figure 8). The secretion of two chain is partial and it is about 50 to 60%(as shown in table 1). The Clone #6D6 gives the maximum secretion of two chain of 60 %.
• Few clones were induced and subjected to HPLC analysis to find out the two chain glargine peaks (as shown in Figure 9 and Figure 10). Successful transformation of ?Kex2p/pGAP into Fglargine production host takes place with the conversion or secretion of two chain glargine is varied from about 10% to 60% (as shown in table 1). However since 100% two chain glargine secretion into the medium was not achieved; a process which increases the secretion of two chain glargine in the medium is required.
Table 1: The percentage conversion of two chain glargine with co-expression of ?Kex2p under the control of GAP promoter.
Clone name /# Injection volume(µls) Precursor Peak area Total peak area Two chain glargine Peak area % conversion achieved
Flargine control 50.00 571.3 571.3 0.00 0.00
Clone #IB4 50.00 727.9 836.9 109 13.02
Clone #5C5 50.00 454.9 826.5 371.6 44.96
Clone #3C1 50.00 403.2 588.2 185 31.45
Clone #4B7 50.00 485.2 731.1 245.9 33.63
Clone #2F6 50.00 1386.5 1531 144.5 9.44
Clone# 6D6 50.00 494.22 1221.02 726.8 59.52
Result:
Results from table 2 indicate that the above process successfully transformed the ?Kex2p/pGAP into Fglargine production host. The colonies are screened for obtaining higher Zeocin resistance clones which will lead to high copy number expression construct. The secretion of two chain glargine is varied from about 10% to 60%.
However we are unable to achieve 100% two chain glargine secretion into the medium.
Example: 6
Co-expression of FLD1 promoter driven ?Kex2p intracellularly:
In order to secrete 100% two chain glargine co-expression is carried out by ?Kex2p under the control of constitutive GAP promoter. Hence it was also decided to use the strong inducible promoter FLD1 to obtain such high secretion.
Example: 7
Cloning of Kex2p under the control of FLD1 promoter:
To secrete 100% two chain glargine directly into the culture medium co-expressing ?Kex2p under the control of FLDI promoter has been carried out.
Procedure:
The FLD1 promoter is a PCR amplified using the following forward primers FLD (BamH1) FP (5’ GCG GAT CCG CAT GCA GGA ATC TCT GGC ACG G 3’) and FLD-Kex FP (A5’ CAA TTC TTG ATA TTC ACA ATG TAT TTG CCA GCA C 3’). The ?Kex2p was PCR amplified using the following reverse primers FLD-Kex RP (5’ GCG AAG TGC TGG CAA ATA CAT TGT GAA TAT CAA GAA 3’) and Kex (Sac) RP (5’ GGA GCT CGT TTA TGC AAA TAA TGA GAG GGC C 3’) (as shown in Figure 10). These products were gel purified using the gel extraction kit and carried out an overlapping PCR to fuse the product using the primers FLD (BamH1)FP and Kex (Sac)RP.
The Fused PCR product is cloned into pTZ57R vector Restriction analysis and sequence verification were carried out to confirm the authenticity (as shown in Figure 11). The restriction digestion analysis and the nucleotide sequences were found to be correct. All the restriction digestion were given the expected fragments (as shown in Figure 11).
Example: 8
Subcloning FLD1-Kex2p into pPICZA vector:
FLD1-Kex2p was subcloned into pPICZA vector as shown in Figure 12 and confirmed the same by restriction digestion (as shown in Figure 13). All the restriction digestion is found to be correct.
Example: 9
Transformation and screening of clones for two chain glargine secretion
The vector FLD1-Kex2p/pPICZA was linearized with BspHI( RcaI) and used for transformation to BICC 9582 which is FGlargine expression host. The transformation was performed by electroporation using Biorad Gene Pulser XL and the transformation mix was selected on YPDS containing 100µg/ml Zeocin. The plates were incubated at 30°C for the transformants to appear.
The transformants were screened by colony PCR to find out integration of FLD1-Kex2p in BICC9582 by using primers FLD promoter FP and Kex(Sac)RP. The expected amplicon size was ~975 bps (see Figure 14). Among the positive clones obtained clone #5 7 23 and 26 were used for evaluation.
Example: 10
HPLC analysis of the secreted Fglargine:
The selected clones were grown in expansion media to develop cell mass. They were then induced using methanol as per the standard protocol. The samples were analyzed by HPLC to check the two chain glargine secretion as shown in Figure 15. FLD1 driven Kex2p is able convert >93% of the precursor into fully folded two chain glargine and secrete into the medium as shown in table 2.
Table 2:
The percentage conversion of two chain glargine with co-expression of ?Kex2p under the control FLD1 promoter.
Comparative percentage of yield improvement of two chain insulin-glargine :
Recombinant insulin-glargine Clone name % yield increased
Insulin-glargine clone without co-expression 0 – 5
Insulin-glargine precursor with Kex2p overexpression using
GAP promoter 60
Insulin-glargine precursor with Kex2p overexpression using
FLD1 promoter >93
Results: FLD1 driven Kex2p is able to convert more than 93% of the precursor into fully folded two chain glargine and secrete into the medium.
Example: 11
SDS PAGE analysis of Two chain glargine clones
The induced samples were analyzed using Tricine SDS PAGE along with controls (as shown in figure 15). It is evident from the gel picture that the clones which are co-expressed with FLD1-Kex2p are secreting two chain glargine into the culture medium very efficiently.
SEQUENCE LISTING
SEQUENCE LISTING
<110> BIOCON LIMITED
<120> SECRETION OF FUNCTIONAL INSULIN GLARGINE DIRECTLY INTO THE
CULTURE MEDIUM THROUGH OVER EXPRESSION OF KEX2P INTRACELLULARLY
<130> IP19971
<160> 8
<170> PatentIn version 3.5
<210> 1
<211> 159
<212> DNA
<213> Synthetic Sequence
<220>
<221> gene
<222> (1)..(159)
<400> 1
tttgttaacc aacatttgtg tggttctcat ttggttgaag ctttgtactt ggtttgtggt 60
gaaagaggtt ttttttacac tccaaagact agaagaggta ttgttgaaca atgttgtact 120
tctatttgtt ctttgtacca attggaaaac tactgtggt 159
<210> 2
<211> 1983
<212> DNA
<213> Pichia pastoris
<220>
<221> Sequence of truncated Kex2P
<222> (1)..(1983)
<400> 2
atgtatttgc cagcacttcg cttagcatgc tggatcttaa ttggtcttag gtctacggag 60
gctttggaga cttccgagag agagatcttt gctctcaagc tggataaatc ctggcttcca 120
acgtttctag aaacgttcca agataagttc aggtatgaaa gacagatcaa cggtttggat 180
gactaccatg ttttttcaca cagtaagaac gaagagtttc agttagagaa ctttaaagtg 240
aagactcttt tgacgcgaga caacgccaat cttcactccg aactgatttc ccacaatgtg 300
gacgaggttc acatgctaag gccctctcat tatttgcata aacgagctcc tgttgtgatg 360
gacaagtcag aggaattaag agaacaaata gcgaaggatt ttgacattga tgacccttta 420
tttgctaaac agtggcatct atttaatcct cgttacccag gacacgacgt gaacgtgtcg 480
caagtttggt acgatggtat cactggaaaa ggtgtagtga ccgccatagt tgatgacgga 540
ctagatatgg acagtaaaga tctcaaagaa tctttttgtg aggaaggatc ttgggatttc 600
aatgccaaca ctagactacc caaaccaaga cttagagacg atcaccacgg aaccagatgt 660
gcagcggaga ttgcagctaa gaagggaaat aaatactgtg gagttggtgt ggcatatgat 720
tcaaaggttt ctggcatcag gattcttagt gataaaatca caccagagga tgaagctctc 780
tccttaatct acggtcttga tgtcaacgac atttattcat gttcatgggg gccagcagac 840
aatggaatca caatgcaagg tcccagctcg ttagtcaaag aagccatgct taaaggagtt 900
caggatggaa gaaagggtaa aggtgcgctg tatgtattcg ccagtggaaa cggagcatct 960
tctggtgata actgcaattt tgacgggtac accaatagca tttattccat aacagttggg 1020
gcaattgata ttaaagggct tcatccacca tacgctgagg cttgctctgc tgtgatgact 1080
gtcacataca gttctggatc gggtgagcac atacacacaa ccgacatcaa cgataaatgt 1140
tctgataccc atggaggaac atccgctgct gcacctttag cggctggtct ttattctttg 1200
gtttatcagg ctaatccgga cctgacttgg cgagatattc aatggctgac tgttttaaca 1260
gccgttcctg ttaacgaaca ggagcctggc tggcagaaga ctgctatcgg taagatgtat 1320
tctcataaat acggatatgg caagatcgat gcatatgcac tggtcaatct agcaagatct 1380
ccagacttcc cgtatctcaa accacaaagc tggatttatg gcactgaggt tcacgaaagc 1440
ttgaatactt ccgaagctaa cggtgtgctg acatccaagt atgaattgac ccaggaggcc 1500
aaagatctaa tgaactttga aaaaattgag catgttacgg ttactgtaga tataaaggcg 1560
gcggaaagag gtaaagttct tgttgagttg atctcccctt caggtgttgt cagtgaattg 1620
gctccctatc gaagaatgga caaggataag gaaggatttc caaattggac gttcatgtca 1680
gtagctcatt ggggtgaaga cgggttagga gagtggatat tgaaaatcac taacaaagaa 1740
ggaaattctg tggtgcttaa ctcctggcaa ataaaattct ttggagaaag tcaagaccct 1800
gaaaaggctg aaaaattctc tttaactaag aaatatgacg aaatattagt caaccctcca 1860
tcttcatcta cttccacgac agtggacacc tcatctacag aagccacttt ttcgtcttcc 1920
tctgtttcag aggcttcagc cacggaaacg gatgtaaaag agacttctac aaccggtgat 1980
taa 1983
<210> 3
<211> 603
<212> DNA
<213> Pichia pastoris
<220>
<221> promoter
<222> (1)..(603)
<400> 3
ggatccgcat gcaggaatct ctggcacggt gctaatggta gttatccaac ggagctgagg 60
tagtcgatat atctggatat gccgcctata ggataaaaac aggagagggt gaaccttgct 120
tatggctact agattgttct tgtactctga attctcatta tgggaaacta aactaatctc 180
atctgtgtgt tgcagtacta ttgaatcgtt gtagtatcta cctggagggc attccatgaa 240
ttagtgagat aacagagttg ggtaactaga gagaataata gacgtatgca tgattactac 300
acaacggatg tcgcactctt tccttagtta aaactatcat ccaatcacaa gatgcgggct 360
ggaaagactt gctcccgaag gataatcttc tgcttctatc tcccttcctc atatggtttc 420
gcagggctca tgccccttct tccttcgaac tgcccgatga ggaagtcctt agcctatcaa 480
agaattcggg accatcatcg atttttagag ccttacctga tcgcaatcag gatttcacta 540
ctcatataaa tacatcgctc aaagctccaa ctttgcttgt tcatacaatt cttgatattc 600
aca 603
<210> 4
<211> 483
<212> DNA
<213> Pichia pastoris
<220>
<221> promoter
<222> (1)..(483)
<400> 4
agatcttttt tgtagaaatg tcttggtgtc ctcgtccaat caggtagcca tctctgaaat 60
atctggctcc gttgcaactc cgaacgacct gctggcaacg taaaattctc cggggtaaaa 120
cttaaatgtg gagtaatgga accagaaacg tctcttccct tctctctcct tccaccgccc 180
gttaccgtcc ctaggaaatt ttactctgct ggagagcttc ttctacggcc cccttgcagc 240
aatgctcttc ccagcattac gttgcgggta aaacggaggt cgtgtacccg acctagcagc 300
ccagggatgg aaaagtcccg gccgtcgctg gcaataatag cgggcggacg catgtcatga 360
gattattgga aaccaccaga atcgaatata aaaggcgaac acctttccca attttggttt 420
ctcctgaccc aaagacttta aatttaattt atttgtccct atttcaatca attgaacaac 480
tat 483
<210> 5
<211> 31
<212> DNA
<213> Pichia pastoris
<220>
<221> primer_bind
<222> (1)..(31)
<400> 5
gcggatccgc atgcaggaat ctctggcacg g 31
<210> 6
<211> 36
<212> DNA
<213> Pichia pastoris
<220>
<221> primer_bind
<222> (1)..(36)
<400> 6
gcgaagtgct ggcaaataca ttgtgaatat caagaa 36
<210> 7
<211> 34
<212> DNA
<213> Pichia pastoris
<220>
<221> primer_bind
<222> (1)..(34)
<400> 7
caattcttga tattcacaat gtatttgcca gcac 34
<210> 8
<211> 31
<212> DNA
<213> Pichia pastoris
<220>
<221> primer_bind
<222> (1)..(31)
<400> 8
ggagctcgtt tatgcaaata atgagagggc c 31
We Claim
1. A process of expressing a fully folded functional two chain insulin glargine that require no further processing to make it functionally active said process comprising steps of
i) cloning a glargine pro-peptide and a protease in Pichia pastoris; wherein the sequence coding for protease is put under the control of a constitutive or inducible promoter;
ii) co-expressing the said pro-peptide and the protease; and
iii) obtaining a fully functional insulin glargine.
2. The Process as claimed in claim1 wherein yield of the fully folded biologically active insulin glargine obtained by the said method is more than 93%.
3. The process as claimed in claim 1 wherein the glargine pro-peptide is set forth as SEQ ID No. 1.
4. The process as claimed in claims 1 to 4 wherein the protease is Kexin endoprotease (Kex2p) set forth as SEQ ID No. 2
5. The process as claimed in claims 1 to 4 wherein constitutive promoter is a GAP promoter.
6. The process as claimed in claim 6 wherein inducible promoter is a FLD1 promoter.
7. The process as claimed in claim 5 wherein the constitutive promoter GAP enables the over expression of Kex2p of SEQ ID No. 2 at levels wherein the protease cleaves the pro-peptide of SEQ ID No. 1 to secrete up to 75% of insulin glargine as a fully folded and functional two chain peptide that requires no further processing to make it active.
8. The process as claimed in claim 6 wherein the inducible promoter FLD1 enables the over expression of Kex2p of SEQ ID No. 2 at levels wherein the protease cleaves the pro-peptide of SEQ ID No. 1 to secrete up to 100% of insulin glargine as a fully folded and functional two chain peptide that requires no further processing to make it active.
9. A process of converting pro insulin glargine into fully folded biologically active insulin glargine said method comprising steps of:
i) obtaining a host cell comprising a nucleotide sequence encoding pro insulin glargine;
ii) co-expressing Kex2p under the control of FLD1 promoter within the host cell to convert the pro-peptide glargine into a fully folded biologically active insulin glargine.
Dated this 29th day of March 2012
Signature:
Name: Durgesh Mukharya
To Of K & S Partners
The Controller of Patent Agent for the Applicant
The Patent Office at Chennai
| # | Name | Date |
|---|---|---|
| 1 | Form-5.pdf | 2012-04-02 |
| 2 | Form-3.pdf | 2012-04-02 |
| 3 | Form-1.pdf | 2012-04-02 |
| 4 | Drawings.pdf | 2012-04-02 |
| 5 | 1228-CHE-2012 FORM-18 09-04-2012.pdf | 2012-04-09 |
| 6 | 1228-CHE-2012 FORM-3 08-06-2012.pdf | 2012-06-08 |
| 7 | 1228-CHE-2012 CORRESPONDENCE OTHERS 08-06-2012.pdf | 2012-06-08 |
| 8 | 1228-CHE-2012 POWER OF ATTORNEY 28-09-2012.pdf | 2012-09-28 |
| 9 | 1228-CHE-2012 CORRESPONDENCE OTHERS 28-09-2012.pdf | 2012-09-28 |
| 10 | 1228-CHE-2012 FORM-1 28-09-2012.pdf | 2012-09-28 |
| 11 | 1228-CHE-2012 CORRESPONDENCE OTHERS 05-10-2012.pdf | 2012-10-05 |
| 12 | abstract1228-CHE-2012.jpg | 2013-04-22 |
| 13 | 1228-CHE-2012 FORM-3 02-12-2014.pdf | 2014-12-02 |
| 14 | 1228-CHE-2012 CORRESPONDENCE OTHERS 02-12-2014.pdf | 2014-12-02 |
| 15 | Other Patent Document [12-08-2016(online)].pdf | 2016-08-12 |
| 16 | InspectionOfRegister.pdf | 2016-09-28 |
| 17 | InspectionOfRegister.pdf_1.pdf | 2017-01-23 |
| 18 | 1228-CHE-2012-FER.pdf | 2017-06-27 |
| 19 | 1228-CHE-2012-OTHERS [09-11-2017(online)].pdf | 2017-11-09 |
| 20 | 1228-CHE-2012-FORM 3 [09-11-2017(online)].pdf | 2017-11-09 |
| 21 | 1228-CHE-2012-FER_SER_REPLY [09-11-2017(online)].pdf | 2017-11-09 |
| 22 | 1228-CHE-2012-DRAWING [09-11-2017(online)].pdf | 2017-11-09 |
| 23 | 1228-CHE-2012-CORRESPONDENCE [09-11-2017(online)].pdf | 2017-11-09 |
| 24 | 1228-CHE-2012-COMPLETE SPECIFICATION [09-11-2017(online)].pdf | 2017-11-09 |
| 25 | 1228-CHE-2012-CLAIMS [09-11-2017(online)].pdf | 2017-11-09 |
| 26 | Marked Up Claims_Granted 298296_29-06-2018.pdf | 2018-06-29 |
| 27 | Drawings_Granted 298296_29-06-2018.pdf | 2018-06-29 |
| 28 | Description_Granted 298296_29-06-2018.pdf | 2018-06-29 |
| 29 | Claims_Granted 298296_29-06-2018.pdf | 2018-06-29 |
| 30 | Abstract_Granted 298296_29-06-2018.pdf | 2018-06-29 |
| 31 | 1228-CHE-2012-PatentCertificate29-06-2018.pdf | 2018-06-29 |
| 32 | 1228-CHE-2012-IntimationOfGrant29-06-2018.pdf | 2018-06-29 |
| 33 | 1228-CHE-2012-RELEVANT DOCUMENTS [02-08-2018(online)].pdf | 2018-08-02 |
| 34 | 1228-CHE-2012-FORM-26 [02-08-2018(online)].pdf | 2018-08-02 |
| 35 | 1228-CHE-2012-Changing Name-Nationality-Address For Service [02-08-2018(online)].pdf | 2018-08-02 |
| 36 | Correspondence by Agent_Power of Attorney_06-08-2018.pdf | 2018-08-06 |
| 37 | Form 27_License_25-03-2019.pdf | 2019-03-25 |
| 38 | 298296-Form 27_Statement of working_16-03-2020.pdf | 2020-03-16 |
| 39 | 1228-CHE-2012_Form 27_Statement of working_03-09-2021.pdf | 2021-09-03 |
| 40 | 1228-CHE-2012_Correspondence And Authorization Letter_03-09-2021.pdf | 2021-09-03 |
| 41 | 1228-CHE-2012-Response to office action [30-04-2022(online)].pdf | 2022-04-30 |
| 42 | 1228-CHE-2012-Form 27_Statement of Working_19-08-2022.pdf | 2022-08-19 |
| 43 | 1228-CHE-2012-Correspondence-Form 27_19-08-2022.pdf | 2022-08-19 |
| 44 | 1228-CHE-2012-Correspondence And Authorization Letter_19-08-2022.pdf | 2022-08-19 |
| 45 | 298296 FORM 27.pdf | 2023-11-17 |
| 46 | 298296-Form 27-240925.pdf | 2025-09-25 |
| 1 | 1228-CHE-2012_19-06-2017.pdf |