Sign In to Follow Application
View All Documents & Correspondence

Stable Immunogenic Protein Having Multiple Cysteine Molecules Process Therefor And Composition Thereof

Abstract: The invention describes a stable immunogenic protein having multiple cysteines molecules wherein the protein is having stability up to two years and purity more than 98% particularly rPvRII and/or rPfF2. It also discloses a method for producing said immunogenic protein comprising the following steps: culturing the host E.coli cells containing a desired recombinant gene construct comprising a codon optimized gene sequence of rPvRII and/or rPfF2 to produce cells in high density; inducing expression rPvRII and/or rPfF2 as inclusion bodies; harvesting the cells and isolating the said inclusion bodies; separating rPvRII and/or rPfF2 from inclusion bodies by repeated sequential washing and solubilizing with chaotrophic agents comprising guanidine hydrochloride and / or urea; purifying the protein by subjecting to melal-chelate affinity chromatography; re-folding of the purified rPvRII and/or rPfF2 obtained in step e) with a redox system to recover a high yield of the soluble protein, followed by further purifying the desired protein by removing impurities by subjecting to chromatography. Further the invention discloses formulation comprising rPvRII or rPfF2, preferably being lyophilized using polysaccharides preferably sucrose, lactose, and pharmaceutically acceptable adjuvants such as aluminum hydroxide, aluminum phosphate, CpG nucleotides, non-CpG nucleotides, Montanide ISA-720, MF-59, Mono-phosphoryl Lipid-A (MPL-A) and QS-21.

Get Free WhatsApp Updates!
Notices, Deadlines & Correspondence

Patent Information

Application #
Filing Date
09 June 2009
Publication Number
21/2011
Publication Type
INA
Invention Field
BIOTECHNOLOGY
Status
Email
Parent Application
Patent Number
Legal Status
Grant Date
2021-03-10
Renewal Date

Applicants

BHARAT BIOTECH INTERNATIONAL LIMITED,
GENOME VALLEY, TURKAPALLY, SHAMEERPET, HYDERABAD 500 078,

Inventors

1. ELLA KRISHNA MURTHY
BHARAT BIOTECH INTERNATIONAL LIMITED GENOME VALLEY, TURKAPALLY, SHAMEERPET, HYDERABAD 500 078,
2. RAVI GANAPATHY
BHARAT BIOTECH INTERNATIONAL LIMITED GENOME VALLEY, TURKAPALLY, SHAMEERPET, HYDERABAD 500 078,

Claims

1. A stable immunogenic protein having multiple cysteines molecules preferably wherein the protein is having stability up to two years and purity more than 98% when prepared by the process comprising; a) culturing the host E. coli cells containing a desired recombinant gene construct comprising a codon optimized gene sequence of a protein to produce cells in high density, b) inducing expression of the target protein as inclusion bodies, c) harvesting the cells and isolating the said inclusion bodies, d) separating the protein from inclusion bodies by repeated sequential washing and solubilizing with chaotrophic agents comprising guanidine hydrochloride and/or urea, e) purifying die protein by subjecting to metal-chelate affinity chromatography, f) re-folding of the purified protein obtained in step e) with a redox system to recover a high yield of the soluble protein, followed by g) further purifying the desired protein by removing impurities by subjecting to chromatography.

2. A protein as claimed in claim 1 is stable for twenty four months at a temperature between 1-8ºC and six months at a room temperature.

3. A protein as claimed in claim 1 is rPvRII and/or rPfF2.

4. A method as claimed in claim 1, wherein the repeated sequential washing is effected by washing with buffer.

5. A method as claimed in claim 1, wherein the buffer used is a low salt buffer consisting of 5-50mM Tris, 2-25mM EDTA, 50-100mM sodium chloride, 1-6M urea, 0.1-1% Triton X-100, pH 6.5-7.5 followed by high salt buffer containing 5-50mM Tris, pH 6.5-7.5 and 0.5-lM sodium chloride.

6. A method as claimed in claim 1 wherein the harvesting, separating, isolating and solubilizing is carried out under denaturing conditions.

7. A method as claimed in claim 1, wherein the refolding is effected employing a buffer containing a detergent - dextrin mixture, a co-solvent and a redox pair.

8. A method as claimed in 7, wherein the detergent used is a non-ionic one, preferably Triton X-100 at a concentration of 0.1-1.0mM, a dextrin, preferably beta-cyclodextrin, L-Arginine as a co-solvent and a redox pair comprising at least one of the following: oxidized and reduced glutathione; L-cysteine - cystamine dihydrochloride, preferably L-cysteine - cystamine dihydrochloride.

9. A method as claimed in 7, wherein the refolding buffer further comprising one or more of the amino acids selected from L-cystine, L-cysteine, L-proline and L-lysine.

10. A method as claimed in claim 1, wherein the re-folded PvRII is further purified by column chromatography to be free from chaotrophic agent, detergents, monomers and multimers.

11. A stable composition comprising of a protein as claimed in claim 1 wherein the protein is present in the range of 10|ig to 100ixg and pharmaceutically acceptable adjuvants.

12. A pharmaceutical composition of a protein as claimed in claim I where in rPvRII or rPfF2, preferably being lyophilized using at least one of the following: sucrose, lactose, maltose, trehalose, melibiose, mannitol, sorbitol and dextrose, or combinations thereof and in the range of 5 to 10% preferably sucrose or lactose and pharmaceutically acceptable adjuvants.

13. A pharmaceutical composition as claimed in claim 12, wherein the pharmaceutically acceptable adjuvants used are selected from, but not limited to: aluminum hydroxide, aluminum phosphate, CpG nucleotides, non-CpG nucleotides, Montanide ISA-720, MF-59, Mono-phosphoryl Lipid-A (MPL-A) and QS-21, used either singly or in combinations thereof for use as a vaccine against malarial infections.

14. A stable highly pure immunogenic protein having multiple cysteines molecules preferably- rPvRII or rPfF2, a process therefor, highly stable pharmaceutical composition thereof for use as a vaccine against malarial infections substantially such as here in described with reference to examples and drawings.

Specification

STABLE IMMUNOGENIC PROTEIN HAVING MULTIPLE CYSTEINE MOLECULES PROCESS THEREFOR AND COMPOSITION THEREOF.

The present invention relates to stable immunogenic protein having multiple cysteine molecules, process therefor and composition thereof.

FIELD OF INVENTION
The invention relates to life sciences particularly biomedical research more particularly to Translational Research in order to develop alternate therapeutic agents as preventive medicine. More specifically, the invention provides a stable immunogenic protein, and a composition containing said protein useful as vaccine having increased purity, stability, immunogenicity, without impairing antigen stability, integrity, and functionality. The vaccine thus obtained is preferably effective against malarial infections using technically & commercially viable and/or industrially feasible process. Particularly, the invention provides an industrially scalable, high yielding, cost effective process for expression, purification and refolding of protein having multiple cysteine molecules enhanced shelf life and immunogenicity. Further, the invention in particular relates to expression, purification and refolding of rPvRII having 12 cysteines useful for prophylaxis of malarial infections in mammals more specifically malarial infections caused by Plasmodium sp. The invention provides unique composition having high antibody titre and enhanced shelf life up to three years.

BACKGROUND OF THE INVENTION:
Recombinant proteins, when expressed in high levels in organisms like E. coli aggregate together to form insoluble matter, called popularly as inclusion bodies. These inclusion bodies have to be brought into solution by using solubilizing agents. After this they have to be purified partially or fully before subjecting the protein to refolding / renaturation thereby enabling them to get their stable, native and functional structure / configuration.
One of the important connections between the amino acids constituting a protein molecule in its tertiary structure is the disulphide bond. This bond is formed exclusively between two cysteines, when present, in a protein molecule. As the number of cysteines in a molecule increases, the possible combinations between them also exponentially increase; but only a few among them are correctly folded, giving the molecule its proper structure and function.

So when looking at the above facts it is clear that, when a protein is having multiple cysteines and also expressed as inclusion body in E. coli, it is really a Herculean task to
get this protein isolated and purified with its structure and function intact and with viable levels of yield even at small scales, without mentioning the industrial scales.
This is applicable to a recombinant protein being a candidate vaccine against Malaria caused by one of the four human malarial parasites, P. vivax.

Malaria remains one of the most important global diseases to tackle, affecting more than 150 million people worldwide annually and causing more than 2 million deaths among them, with more than 40% (2 billion people) of the world population at risk. The disease is caused by protozoan parasites belonging to the genus Plasmodium with the two species P. vivax and P. falciparum being the most important ones for humans. Of these two the latter can cause death as it can cross the blood-brain barrier and cause cerebral inflammation. Issues such as (a) the complexity of the parasite's life cycle which traverses two hosts, a vertebrate one in humans and an invertebrate one in female Anopheles mosquitoes, for completion, and (b) presence of a variety of antigenic epitopes displayed by the several life stages of the pamsite posing a huge challenge to the host immune system, present a big challenge in the development of an effective vaccine against the parasite. Since all drug-based treatments are not working long-enough consistently, due to the development of resistance by the parasite to most of the drugs used to treat the disease, development of an effective vaccine promises to be the best solution in containing the disease.

The first vaccine developed that has undergone field trials is the SPf66, developed by Manuel Elkin Patarroyo in 1987. It presents a combination of antigens from the sporozoite (using circumsporoziote protein -CSP- repeats) and merozoite stages of parasites. Though phase I trials demonstrated 75% efficacy rate and the vaccine appeared to be well tolerated by subjects and immunogenic, phase lib and III trials were not only less promising with the efficacy falling to between 38.8% and 60.2%, but a trial carried out in Tanzania in 1993 and the most recent (though controversial) study in the Gambia did not show any effect. Thus, despite the relatively long trial periods and the number of studies carried out, it is still not known how the SPf66 vaccine confers immunity, and therefore remains an unlikely solution to malaria.

The CSP was the next vaccine developed that initially appeared promising enough to undergo trials. It is also based on the CSP, but additionally has the recombinant (Asn-

Ala-Pro 15Asn-Val-Asp-Pro)2--Leu-Arg(R32LR) protein covalently bound to a purified Pseudomonas aeruginosa toxin (A9). However at an early stage a complete lack of protective immunity was demonstrated in those inoculated. The study group used in Kenya had an 82% incidence of parasitaemia whilst the control group only had an 89% incidence. The vaccine intended to cause an increased T-lymphocyte response in those exposed; this was also not observed, thus proving to be ineffective.

The NYVAC-Pf7 multistage vaccine developed incorporating seven P. falciparum antigenic genes like CSP and sporozoite siuface protein 2 (called PfSSP2) derived fix)m the sporozoite phase, the liver stage antigen 1 (LSAl), three from the erythrocytic stage (raerozoite surface protein 1 –MSP1, serine repeat antigen -SERA and apical membrane antigen -AMA-1) and one sexual stage antigen (the 25-kDa Pfs25). This was first investigated using Rhesus monkevs and produced encouraging results. However, trials in humans gave mixed results warranting evidence with regard to efficacy.

In 1995 a field trial involving [NANP] 19-5.1 proved to be very successful. Out of 194 children vaccinated none developed symptomatic malaria in the 12 week follow up period and only 8 failed to have higher levels of antibody present. The vaccine consists of the schizont export protein (5.1) and 19 repeats of the sporozoite surface protein PSIANP]. Limitations of the technology exist as it contains only 20%i peptide and has low levels of immunogenicity. It also does not contain any immunodominant T-cell epitopes.

RTS,S is the most recently developed recombinant vaccine. It consists of the P.
falciparum CSP protein fix)m the pre-erythrocytic stage. The CSP antigen causes the production of antibodies capable of preventing the invasion of hepatocytes and additionally elicits a cellular response enabling the destruction of infected hepatocytes. The CSP vaccine presented problems in trials due to its poor immunogenicity. The RTS,S attempted to avoid these by fiising the protein with a surface antigen from Hepatitis B, hence creating a more potent and immunogenic vaccine. When tested in trials an emulsion of oil in water and the added adjuvants of monophosphoryl A and QS21 (SBAS2), the vaccine gave protective immunity to 7 out of 8 volunteers challenged with P. falciparum.

This clearly indicates that the task of developing a vaccine that is of dierapeutic and potentially preventative benefit for malaria is a complex process. No effective vaccine
for malaria has so far been developed despite continuous R & D in the area. Hence, there is immense necessity for developing an effective stable vaccine.

The main area of survival of the parasite in the human host is the reticulo-endothelial system which includes organs and tissues such as liver and blood. Most of the growth and maturation of the parasite occurs in the red blood cells of the blood. Two soluble antigens, Duffy Antigen Binding Protein (DAB) and Sialic Acid Binding Protein (SABP), appear in the culture supernatant after infected erythrocytes release merozoites. Immunochemical data indicate that DABP (a -135-kDa size protein which specifically binds Duffy blood group determinants) and SABP (a ~175-kDa protein which binds specifically to glycophorin sialic acid residues on erythrocytes) are the respective ligands for the P. vivax and P. falciparum, mediating the specific molecular interactions for the invasion of RBCs by malaria parasites. Duffy and sialic acid receptors on erythrocytes possess specificities of binding which are identical either in soluble or membrane bound form.

It was specifically found out that P. vivax requires interaction with Duffy blood group antigen for entrance while P. falciparum EBA-175 interacts with the sialic acid residues on glycophorin A to mediate erythrocyte invasion. Parasite proteins that bind these RBC receptors to mediate invasion include P. vivax Duffy binding protein (PvDBP) and P falciparum sialic acid binding protein (known as EBA--175). The functional erythrocyte binding domains of both proteins were found to lie in a conserved, Cysteine-rich N terminal regions referred to as P. vivax region II (PvRII) and P. falciparum region Y. (PfF2).

The P. vivax region II (PvRH) was expressed in the BL21 (DE3) strain of £. coli [3 Recombinant PvRII was incorrectly folded upon expression and accumulated 2 inclusion bodies. These inclusion bodies were solubilized using denaturants, purified under denaturing conditions by metal affinity chromatography, refolded by a rapid dilution method and purified to homogeneity by Ion exchange chromatography to final obtain milligram quantities of pure, functionally active protein which bound specifically with Duffy positive human erythrocytes.

Rabbits immunized with PvRII thus produced and formulated in Freund's adjuvant, well as mice immunized with PvRII formulated with the human compatible adjuvants

Montanide ISA720 and AS02A, were shown to develop high-titre binding inhibitory antibodies that block the binding of Duffy positive erythrocytes to COS-7 cells expressing PvRII on their surface. The protective efficacy of recombinant PvRII formulated in Freund's and Montanide ISA720 adjuvants was tested in Aotus monkeys. Specific antibody titers were determined by an enzyme-linked immunosorbent assay after each of three doses of 50 micrograms of protein administered by the subcutaneous route. Immunization with PvRII formulated in Freund's adjuvant yielded higher antibody titers than immunization with the Montanide ISA720 formulation and offered partial protection. Although the Montanide ISA720 formulation was immunogenic, it did not provide any protection. Given' the immunogenicity and partial protection observed, further research was carried out.

It was observed that, one of the major obstacles for optimal expression of Plasmodium
genes in E, coli is the difference in codon usage frequency between these two organisms.
When the native gene construct was expressed in E. coli and purified, few truncated
products of PvRII were also co-purified (identified by Western Blotting) and this gave
problems in scaling-up the process. A synthetic gene for PvRII with codons optimized
for expression in E. coli was designed to overcome this existing problem. It has two fold
advantages. (1) Expression of recombinant using synthetic gene gave higher yields when
compared with the native gene construct; and (2) the codon optimization significantly
reduced the production of truncated PvRII fragments that are observed in case of
expression using native gene. A high cell density fermentation to express the protein in
high levels was optimized, but the difficulty in getting a good yield of final purified
protein remained. |,

Another major difficulty with production of PvRII is that it has 12 cysteines in its primary structure as shown in Table-1. All these are required to have to be linked-up to get the native structure and functionality. The transcribed product of this synthetic gene is a 336 amino acid, single-chain protein. The cysteine residues are present in positions 25, 38, 45, 54, 108, 185, 223, 235, 240, 244, 313 & 315. Within the chain the critical binding residues for Duffy Antigen Receptor for Chemokines (DARC) lie in the central region of the chain having the cysteine residues 5 to 8.

Table 1: Synthetic rPvRII Primary Structure with cysteines marked in different
colour:

MDHKKTISSAIINHAFLQNTVMKNCNYKRKRRERDWDCNTKKDVCIPDRRYQL
CMKELTNLVNNTDTNFHRDITFRKLYLKRK
LIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKWE
NNLRSIFGTDEKAQQRRKQWWNESKAQIW
TAMMYSVKKRLKGNFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKL
KEKCDGKINYTDKKVCKVPPCQNACKSYDQ
WITRKKNQWDVLSNKFISVKNAEKVQTAGIVTPYDILKQELDEFNEVAFENEIN
KRDGAYIELCVCSVEEAKKNTQEWTHHHHHH

As those who are familiar with the art of renaturation know, presence of 12 cysteines means six disulphide bonds in the chain and the chance of getting the right disulphide
linkages in all six cases is very difficult when it is given that the possible combinations
of disulphide bonds in this case are many. These difficulties resulted in a process with an
unviable yield of less than 5%, though it was enough to test the protein and its
functionality. A reference is made to Singh S., K. Pandey, R. Chattopadhayay, S.
Yazdani, A. Lynn, A. Bharadwaj, A. Ranjan and C. E. Chitnis. 2001, 'Biochemical, biophysical and functional characterization of bacterially expressed and refolded receptor binding domain of Plasmodium vivax Duffy binding protein'. Journal of Biological Chemistry, 276:17111-17116. However, if this had to go to human use higher yields are required. Moreover, the cost of the process also has to be kept low in order to make the product cheaper and affordable for mass use. The synthetic gene construct was taken up for further work to develop a method to have better quality purified, functional PvRH with increase in yield. This is achieved by specially designed method of refolding of protein. It is pertinent to mention here that the modified method disclosed in this invention works well for other proteins with multiple cysteines in their structure and also expressed as inclusion body.

The proteins thus purified are formulated for using as vaccine candidates. During the last two decades, a variety of technologies have been investigated to improve the widely-used adjuvant based on aluminum salts. These salts are unfavorable, since they develop side effects such as inducing local inflammation, which is also the basis for the extended side-effect pattern of this adjuvant. AH small-scale animal studies with rPvRII and many of the other information available on recent vaccine trials suggested that though alum,
the gold-standard adjuvant, elicited decent response to the antigen(s) when used as the adjuvant, much better responses were observed with other adjuvants. Though one of the important criteria for an adjuvant being that it should not alter the structural / functional characteristics of the active molecule, some of the formulations were shown to be destabilizing the proteins due ,to the interaction with the antigens or by their physical instability, thereby precluding or restricting the usability of the adjuvant. This necessitated new formulation strategies where the benefits of the adjuvant could be used without compromising the stability of the protein or formulation.

The oil based adjuvants proved to satisfy this requirement. The oil based adjuvants such
as QS21, MPL-A, MF59, AS02A (SBAS2) and Montanide ISA-720 were used for
preparing formulations and evaluated under clinical trials. The newer human adjuvants
including MF59, ISCOMS, QS21, AS02 and AS04 have exhibited substantially higher
local reactogenicity and systemic toxicity than alum.

As it is apparent from the disclosure herein before, the existing prior art is unable to
develop a stable immunogenic protein having multiple cysteines with high purity while maintaining integrity and functionality of native protein due to problems posed by getting appropriate disulphide linkages during refolding of the target protein and co-purification of host protein along with target protein. Other problems associated with the existing prior art are the stability of the protein, low yield of the protein and stability of the formulation of such protein making them unfit for commercially viable and being used effectively as vaccines for long period. The inventor, after prolonged and painstaking R&D, has developed a stable immunogenic protein having multiple cysteines with purity above 98%, stability up to 2 years at low temperature & six months at room temperature, and integrity shown by its functionality during stability studies. Further, the process is industrially feasible with increase in yield fit)m 5% to about 20% and the composition stable over 3 .years. The novelty resides in eliminating formation of aggregation, eliminating presence of host proteins and getting appropriate disulphide linkages during refolding of target protein. Additionally, the lyophilization of protein with sucrose before developing formulations adds to the stability of the composition.

OBJECTIVE OF THE INVENTION

The main object of the invention is to provide a stable immunogenic protein, and a composition containing said protein useful as vaccine obviating the drawbacks of existing prior art.

The other object of the present invention is to provide stable immunogenic protein having increased purity, stability, immunogenicity, without impairing antigen stability, integrity and functionality.

Another object of the present invention is to provide stable immunogenic protein having multiple cysteine molecules.

Yet other object of the present invention is to provide stable immunogenic protein that can be used as a vaccine preferably effective against malarial infections.
Yet another object of the present invention is to provide a process for the production of a protein, particularly protein having multiple cysteine molecules, which is technically & commercially viable and/or industrially feasible.

Still other object of the present invention is to provide a process, for expression, purification, and refolding of multiple cysteine molecules containing protein, with enhanced shelf life and immunogenicity, that is industrially scalable, high yielding, cost effective.

Still another object of the present invention is to provide a process for expression, purification and refolding of rPvRII having 12 cysteines useful for prophylaxis of malarial infections in mammals more preferably malarial infections caused by Plasmodium sp.

Yet other object of the present invention is to provide unique composition having high antibody titre and enhanced shelf life up to three years.

DESCRIPTION OF THE ACCOMPANYING DRAWINGS:
Figure 1 shows SDS-PAGE profile of induced and un-induced samples of a fermentation batch. The Lanes 1 & 5 show un-induced sample. Lane 2 with Standard PvRII, Lanes 3 & 4 induced sample. The extra band seed in the induced sample Lanes corresponding to the Marker is the rPvRII protein band.

Figure 2 shows SDS-PAGE profile of fractions from metal affinity chromatography. Lane shows pre-load sample, Lane 2 flow-through. Lane 3 marker. Lane 9 Standard and Lanes 4 to 8 the elutes 1 to 5, respectively.

Figure 3 shows SDS-PAGE profile of post-Refolding, C& DF material. Lane 1 shows Standard, Lane 2 retentate sample, Lane 3 permeate sample and Lane 4 Molecular weight Marker.

Figure 4 shows SDS-PAGE Profile of reduced samples' of Ion-Exchange Chromatography run. Lane I shows Standard, Lane 9 with Molecular weight Marker, Lane 10 with pre-load sample, Lanes 2 to 8 with elutes 7 to 1 in that order, respectively.

Figure 5 shows SDS-PAGE Profile of non-reduced samples' of Ion-Exchange Chromatography r\m. Lane 1 shows Standard, Lanes 2 to 8 show elutes 1 to 7 in that order, respectively.

Figure 6 shows SDS-PAGE Profile of purified rPvRII under reducing and non-reducing conditions. Lane 4 shows Standard (reducing). Lane 7 Standard (non-reducing). Lane 5 Molecular weight Marker, Lanes 1 to 3 bulk antigen (reduced) at 2fig, 4ng and 8^g respectively, Lanes 8 and 9 bulk antigen (non-reduced) at 4μg and 8μg respectively. Lane 6 is blank.

Figure 7 shows the RP-HPLC profile of purified rPvRII.
Figure 8 shows the EB A-Western profile of purified rPvRII Lane 3 shows the Coloured Molecular weight Marker^ Lanes 4 & 9 Standard, Lanes 1 & 2 Bulk antigen. Lanes 5 & 7 negative control and Lanes 6 & 8 positive control.

Figure 9 shows the accelerated and real-time stability profiles of rPvRII bulk antigen. The protein content and purity by RP-HPLC, were plotted as graphs and show that the bulk antigen (protein) is quite stable at the storage conditions tested.

Figure 10 shows the accelerated and real-time stability profiles of rPvRII-alum formulation. The protein content and antigen adsorption estimated by BCA method were plotted as graphs and show that the alum-formulated rPvRII is quite stable at the storage conditions tested.

Figure 11 shows the accelerated and real-time stability profiles of rPvRII-lyophilized formulation. The protein content and purity by RP-HPLC were plotted as graphs and show that the lyophilized-rPvRII is quite stable at the storage conditions tested.

Figure 12 shows the antibody titres produced by outbred Balb/C mice against different rPvRII+ adjuvant formulations. The antibody titres shown are the end-point titres elicited by the formulated material in sera samples collected from bleedings done at different days pre- and post-inoculation and the OD measured at 490nm.

STATEMENT OF INVENTION:
Accordingly the present invention provides a stable immunogenic protein having multiple cysteines molecules wherein the protein is having stability up to two years and purity more than 98%.
According to one of the embodiments the protein may be stable for twenty four months at a temperature between 2-8°C and six months at a room temperature. Further the protein may preferably rPvRII and/or rPfF2.

In accordance with the other aspect of this invention there is provided a method for producing immunogenic protein as disclosed herein before comprising the following steps:

a) culturing the host E. coli cells containing a desired recombinant gene construct comprising a codon optimized gene sequence of rPvRII and/or rPfF2 to produce cells in high density,
b) inducing expression rPvRII and/or rPfF2 as inclusion bodies,
c) harvesting the cells and isolating the said inclusion bodies,
d) separating rPvRII and/or rPfF2 from inclusion bodies by repeated sequential washing and solubilizing with chaotrophic agents comprising guanidine hydrochloride and / or urea,
e) purifying the protein by subjecting to metal-chelate affinity chromatography,
f) re-folding of the piuified rPvRII and/or rPfF2 obtained in step e) with a redox system to recover a high yield of the soluble protein, followed by
g) further purifying the desired protein by removing impurities by subjecting to chromatography.

According to one of the embodiments, the repeated sequential washing may be effected by washing with buffer.

According to the other embodiment the buffer used may be a low salt buffer consisting of 5-50mM Tris, 2-25mM EDTA, 50-lOOmM sodium chloride, 1-6M urea, 0.1-1% Triton X-100, pH 6.5-7.5 for first two washings followed by high salt buffer containing 5-50mM Tris, pH 6.5-7.5 and 0.5-1 M sodium chloride .

According to another embodiment, the harvesting, separating, isolating and solubilizing may be carried out under denaturing conditions.

According to yet other embodiment, the refolding may be effected employing a buffer containing a detergent - dextrin mixture, a co-solvent and a redox pair.
According to yet another embodiment, the detergent used may be a non-ionic one, preferably Triton X-100 at a concentration of 0.1-l.OmM, preferably 0.3-0.7mM; dextrin, preferably cyclodextrin more preferably beta-cyclodextrin at a concentration of 5-20niM and more preferably at 12-18niM; L-Arginine as a co-solvent being added in the range of 0.2-2.0M, more preferably at 0.4-0.8M and a redox pair comprising at least one of the following; oxidized and reduced glutathione; L-cysteine - cystamine dihydrochloride, preferably L-cysteine - cystamine dihydrochloride. ;

According to still other embodiment the refolding buffer further comprising one or more of the amino acids selected from L-cystine, L-cysteine, L-proline and L-lysine. According to still another embodiment, the re-folded protein may further be purified by column chromatography to be free from chaotrophic agent, detergents, monomers and multimers.

According to yet other aspect of the present invention there is provided a stable composition comprising of a protein as described herein above wherein the protein may be present in the range of 10μg to 100 μg and pharmaceutically acceptable adjuvants.
A pharmaceutical composition of a protein, rPvRII or rPfF2, may preferably be lyophilized using at least one of the following: sucrose, lactose, maltose, trehalose,
12 melibiose, mannitol, sorbitol and dextrose, or combinations thereof and in the range of 5 to 10%, preferably sucrose or lactose and pharmaceutically acceptable adjuvants.
A pharmaceutical composition, wherein the pharmaceutically acceptable adjuvants used may be such as, but not limited to: aluminum hydroxide, aluminum phosphate, CpG nucleotides, non-CpG nucleotides, Montanide ISA-720, MF-59, Mono-phosphoryl Lipid-A (MPL-A) and QS-21, used either singly or in combinations thereof for use as a vaccine against malarial infections.

DETAILED DESCRIPTION OF THE INVENTION
Throughout this disclosure, various publications and patents are referenced. The disclosures of these publications, patents and applications in their entirety are hereby incorporated by reference into this disclosure in order to more fully describe the state of the art as known to those skilled therein as of the date of the invention described and claimed herein.

The invention provides a series of specific steps, with necessary modifications as may be done by those who are competent with the art, to be used in the upstream and downstream processes to obtain the target protein in a pure, active form. The process starts with culturing the host cells containing the synthetic recombinant gene for expressing the target protein, first in seed inoculum stage and using this seed material to inoculate a bioreactor to produce the cells in high density and then inducing the expression of target protein. This expressed protein aggregates as inclusion bodies inside the host cell and these cells are then broken and the inclusion bodies are separated from the lysate, washed and solubilized using a chaotrophic agent like guanidine hydrochloride at 6-8M concentration. The solubilized inclusion bodies are clarified by centrifugation and the supernatant is run through metal affinity chromatography and the positive fractions are pooled and concentrated. The concentrated protein is then refolded in the specific combination of buffer components and conditions used in this process; the refolded protein is then concentrated and diafiltered to remove the chaotrophic agent and detergents used in the prior steps and run through ion exchange chromatography to purify the monomers from dimers, multimers and other impurities. The pure flections are then concentrated and sterile filtered before further storage or use.

The final yield of the purified protein in this process ranges from \5% to 25% at different scales of refolding done and well above the levels achieved for such proteins as described in prior art.

This and other objects and advantages of the present invention will be apparent from the following description. It should be understood that the following is merely a description of the preferred embodiments, and is not intended as a description of all possible embodiments. The claims should be looked to determine the full scope of the invention.
The preferred embodiments of the invention are described in detail with the aid of following examples and accompanying drawings. Various modification(s) that may be apparent to one in the art are intended to fall within the scope of this invention.

EXAMPLE 1:

Isolation and Purification of recombinant PvRII expressed as inclusion body in E,
coli '

Fermentation and expression of target protein at high cell concentrations:
The first step in the process sequence is the preparation of inoculum. Seed culture from a
vial among the stock of vials preserved at or below -70 deg. C is inoculated into the fully
defined fermentation medium to get high cell density. The inoculum preparation can
consist of two or three stages of scale-up before the last-stage inoculum is added to the
medium sterilized in situ in the fermentor. Between each transfer samples are taken and
checked for cell density, pH and culture purity, the last of which is done by microscopic
examination of wet smear or Gram-stained smear of culture, to confirm compliance to
specifications; each stage involves transfer of 5% to 10% of inoculum to the succeeding
stage, which is grown in a shake-incubator at 150-250 rpm for 8-12 hours at 33
deg.C-37 deg. C.

The initial conditions of fermentation are set as follows: Temperature at 37±2 deg.C, pH at 6.9 ±0.1, stirring speed at 200-400 rpm and 100% availability of the oxygen through compressed air given at 4 to 8 litres.min-1. The fermentation is monitored continuously and that parameters are controlled, automatically as per pre-set programmes or manually as required to be within pre-set limits, which are changed as per requirements during fermentation as known to those conversant with the art. Once the entire carbon source
and other nutrients in the medium are exhausted by growing culture, fed-batch cultivation is started by addition of a fed-batch solution containing modified quantities of the nutrients in the basal medium as known to those conversant with fermentation. During this phase the dissolved oxygen (DO) level is maintained between 10% and 50%, preferably between 10% and 30% or 20% and 40%.

During the entire fermentation periodic samples are taken and in-process parameters as required to monitor growth. This fed batch stage is continued until the desired concentration of cells is reached; then the culture is induced with l-2mM of Isopropyl β-
D thiogalacto pyranoside (IPTG). During this induction phase the DO level is maintained at a higher level than done during the fed-batch stage as required to improve induction of the target protein. This induction phase extends between 3 and 6 hours, preferably not later than that.

The final OD and PCV after harvest are between 130-160 and 18%-24%, respectively. The final wet biomass obtained ranges from 6 Kgs. to 8 Kgs. for a SOL batch (110 g. to 160 g.litre-1) fermentation.

Harvesting and washing of cells:
For cell harvesting and washing, a Tangential Flow Filtration (TFF) cassette module like PROSTAK of Millipore Corporation, U.S.A, having a porosity of 0.45^m-0.6^mi is connected to the fermentor. The flow-rates of permeate and retentate are controlled to get an optimum cross-flow rate. The cells are concentrated to a level of approximately 20% to 40% of their initial volume and then buffer exchanged against washing buffer containing 5-10mM Tris buffer, 2-5mM Disodium salt of Ethylene di-amine tetra-acetic acid (Titriplex), 50-lOOmM Sodium chloride, pH 7.8±0.2 to the cells following known procedure as practiced by those experienced. The final volume at this stage is to be maintained between 60% and 90% of original harvested cell volumes. The OD of the total cell suspension is then checked and adjusted to be between 80 and 120. During this operation the temperature of the culture is maintained below 20 deg.C, preferably as required to prevent denaturation of proteins by prolonged exposure to higher temperatures.

Cell lysis and separation of inclusion bodies:

To the cell suspension under stirring are added a detergent Uke Triton-X 100 (0.5-1.0%), protease inhibitor like Benzamidine hydrochloride (5-10 mM), Dithiothreitol (DTT, 5-lOmM) and Lysozyme (20-30 mg.litre"'). This cell suspension is stirred for 10 to 20 minutes and lysed by passing it, two to four times, through Dynomill as known to those experienced in the art. Lysis is monitored by checking OD and using microscopy of samples after each pass. After required breakage of the cells, of up to 95% cell lysis, the suspension is centrifuged at 4500 to 5500 x g. for 30 to 60 minutes at 2 to 8 deg.C and the supernatant is collected separately.

Washing and solubilization of inclusion bodies:
To one volume of the total pellet about 7-10 volumes (vol. in mL per weight in gms.) of IB wash buffer-1 containing 5-lOmM Tris buffer 2-5mM Titriplex, 50-lOOmM Sodium chloride, 2-41VI Urea and 0.5-1.0% Triton X-100, pH 7.3 ± 0.2 is added, stirred for 15 to 30 minutes and centrifiiged at 4500 to 5500 x g. for 30-60 minutes at 2-8 deg.C. The supernatant is collected separately and the pellets are resuspended in the same buffer as before and the process is repeated once more. To the pellet obtained after the second wash, IB wash buffer--2 containing the constituents as in buffer-1 above minus urea, EDTA and detergent but increased concentration of sodium chloride at 0.5-IM is added at 3-5 volumes of the total pellet weight, stured for 15-30 minutes and centrifuged at 4500-5500g. for 30-60 minutes at 2-8 deg.C. All the washes collected are checked by SDS-PAGE analysis for no or not very significant loss of the target protein in the lysate supernatant and IB washes. This aovel 'two buffer - three step' wash resulted in removal of most of the host-cell proteins, which have to be within certain limit in bacterial produced proteins to be used in pre-clinical and clinical evaluations, contaminating the target protein in the inclusion bodies.

The final washed IB pellet is then added with 7-10 volumes of the buffer (5-lOmM Tris buffer, 50-lOOmM Sodium di-hydrogen phosphate, di-hydrate, 50-lOOmM Sodium chloride, 6-8M Guanidine-HC1, pH 8.0) for solubilising them and stirred at room temperature (20-25 deg.C) up to overnight. After this the solubilized material is centrifuged at 4500-5500g. for 60-90 minutes at 2-8 deg.C. The clear supernatant is collected, checked by SDS-PAGE for the presence of the target protein and then taken for next step.
16

Immobilized metal affinity chromatography (IMAC):
The next step is the immobilized metal affinity chromatography using the Streamline chelating matrix and a Streamline column obtained from Amarsham Pharmacia (GE Healthcare), U.S.A. The matrix is charged with 50-lOOmM Nickel sulphate, washed with distilled water and equilibrated with 3-5 volumes of solubilization buffer. After equilibration, the flow direction is changed to expand the matrix 2~3 times of its original packed height with the sample loaded. The sample is passed for totally 3-5 times through the column, maintaining the expanded state to a constant level. For further washings and elution, the buffer containing 5-lOmM Tris, 5-lOOmM Sodium di-hydrogen phosphate di-hydrate, 6-8M Guanidine-HCI^ is used with only the change in pH. At the end of the loading, washing of the matrix is done in the expanded state itself using 2-3 (packed bed) volumes of IMAC wash buffer-1 with pH 8.0, followed by washing in the expanded state itself using 5-8 (packed bed) volumes of IMAC wash buffer-2 with pH 6.3. After this washing flow direction is changed and elution is done with 4-5 volumes of the Elution buffer with pH 4.3. Elutes are collected as per requirements to enable fractionation of purified protein using bed-volume as the criteria, in appropriate sterile containere, sampled and analyzed for protein concentration / content and purity by SDS-PAGE. Protein estimation is done by Bradford method and also by checking the sample OD at 280nm and using the molar extinction co-efficient value of 1.815 OD@280nm = 1 mg/mL of the target protein.

IMAC elutes having more than 60% target protein are pooled and the protein concentration and content of the pool is checked and calculated. If required, the elutes are concentrated using 10kD TFF membrane cassettes to achieve a protein concentration of not less than 3.6 mg/ml. The sample is then is added with 2-lOmM of DTT, mixed and left up to overnight at 2-8 deg.C.

Refolding and diaflltratioa:

The next step of refolding is done using a chilled (to -10 deg.C) buffer having the following components: 50mM Tris buffer, ImM Titriplex, IM Urea, 0.5M Arginine-HC1, 2mM L-cysteine and 0.67mM Cystamine dihydrochloride (the latter two acting as the redox reagents) and 0.57mM of the detergent Triton X-100, pH 7.2 to 7.4. This refolding system was chosen after many trials with different components and
17 compositions; the presence of co-soJvent like arginine-HC1 and redox pair like Cysteine - Cystamine dihydrochloride were not known to be used along with the detergent - cyclodextrin pair in the total system before. However, when tried in combination only the increases in yields were better. This is probably because of the presence of 12 cysteines and therefore possibly six correct disulphide bonds to be formed in the tertiary structure to confer functionality to the protein. Arginine-HCl, the co-solvent, works like an artificial chaperone and this limits the aggregation, the possibility of whose formation is more as the number of cysteines in the molecule increase. The concentration of arginine-HC1 tried in the system carried from 0.2M to l.OM and there was significant increase in the refolding efficiency up to 0.5M concentrations and after that up to 0.8M levels there was not much increase and continuing on up to IM levels resulted in slight drop in the refolding efficiency. The novel redox pair of cysteine – cystamine dihydrochrolide helps in formation and reshuffling of the disulphide bonds. The use of other redox pairs like GSSG:GSST (oxidized and reduced glutathione), and other detergents tried like CTAB (cetyl-trimethyl ammonium bromide) in the buffer system did not give similar yields in parallel experiments done to optimize the conditions of refolding (data not shown). The pH used was about 1.0 to 2.0 pH points down from the
pi of the target protein (here the pi of PvRII is -8.9). The same refolding buffer-complex
was used to check refolding at different temperatures, viz. 4 deg.C, 10 deg.C and 25
deg.C to check for efficiency. The one done at 10 deg.C worked better than the other two
done at lower and higher temperatures. The concentration of protein added into the
system for refolding was also checked at various levels, from 60 mg.litre" to 240
mg. litre '' and level mentioned above was chosen based on the better results obtained in the experiments. Two other methods with change of components as follows, but keeping the protein concentration and temperature same as above were tried.

The DTT-treated protein at a concentration of at least 3.6 mg/mL is added to the buffer under stirring in a vessel, for a fmal concentration of 120 mg.litre1-. After this mixture is stirred for 10-20 minutes to ensure complete mixing of the protein in the buffer, 16mM beta-cyclodextrin solution is added imder stirring to it for a fmal concentration of 4.8mM. The air inside the vessel is flushed-out using Nitrogen gas purging for a few minutes to prevent any unwanted effect on the redox potential. This reaction with mild stirring continues for about 20-28 hours at ~10 deg.C.

After this reaction the refolding mixture is subjected to a concentration and diafiltration step using 10-kDa TFF membrane cassettes and to about 15%-25% of the initial volume and then brought into 50mM Phosphate buffer containing IM Urea, pH 7.6 to 8.0. The final volume of the concentrated and diafiltered refolded protein would be about 20%-30%) of initial volume. This material is filtered through a 20-50nm membrane pre-filter to remove any aggregates, sampled and then taken for the next step.

Ion exchange chromatography / Diafiltration / Sterile Filtration:

The next step is the anion exchange chromatography, using Toyopearl-SP 650C as the matrix and 50mM Phosphate buffer. The refolded, diafiltered and pre-filtered sample is loaded onto the matrix. Washing and elution are done using step gradient of NaCI concentration, from 50mM to 500niM, in phosphate buffer. Volumes of all the factions collected range from 0.5 to 2 bed volumes according to the requirement. These factions including the flow-through and washes are analyzed for protein concentration using OD@280nm (1.834 OD@280 = mg/mL of native target protein) and/or BCA assay and purity by SDS-PAGE. Fractions having mostly only the target protein are pooled and then concentrated and diafiltered into 10mM Phosphate buffered saline using 10-kDa TFF cassette. The final concentrated protein is checked as above for concentration and purity. The final protein bulk is then sterile-filtered using 0.22 ^m modified PVDF
membranes (capsule filter) and stored at 2-8 deg.C.

EXAMPLE 2:
In this the protein purified and concentrated after IMAC run as above in Example 1 is taken for refolding. Refolding is done using the same conditions as given in example 1 above with the modification of the redox system in refolding buffer constituents as follows: 50mM Tris buffer, ImM Titriplex, IM urea, 0.5M Arginine-HC1, ImM Cystine, pH 7.2 to 7.4. No cyclodextrin is used. The concentrations of the buffer constituents at ±100% from above levels were tried and the given level is selected based on the results.

EXAMPLE 3:

In this the protein purified and concentrated after IMAC run as above in Example 1 is taken for refolding. Refolding is done using the same conditions as given in example 1 above with the modification of the redox system in refolding buffer constituents as
follows: 50mM Tris buffer, ImM Titriplex, IM urea, SmM Lysine, 2mM Proline, pH 7.2 to 7.4. No cyclodextrin is used. The concentrations of the buffer constituents at ±100% from above levels were tried and the given level is selected based on the results.

The results of refolding yields obtained in the three examples given above are given in Table-2. The final product yield from die levels expressed was about 17% to 25%, much higher than the 5% mentioned for this protein in earlier process shown in the prior art and the final purity of the target protein is more than 98%,

Out of the three methods followed for refolding. Example 2 gave the highest yield, followed by methods followed in Examples 1 and 3.

Table - 2: Results of Yields for different Refolding Methods followed

Refolding Method Description as in Protein Cone. Used for RF Ion-Ex. Yield (%) Final Yield
Example 1 4.80mg/ml 24.5% 22.5%
Example 2 5.45 mg/ml 25.8% 24.2%
Example 3 4.40 mg/ml 18.8% 17.5%
EXAMPLE 4: Characterization of the final bulk protein:

The final proteins obtained using all the refolding methods above were analyzed for protein content by BCA assay and/or OD@280nm and/or RP-HPLC. The purity was checked by SDS-PAGE and RP-HPLC assays. Each bulk was also checked for extraneous contaminants like host-cell proteins and nucleic acids, endotoxins, residual amount of nickel (by fluorimetric analysis) and presence of any free cysteine by Ellman Test.

The most important functional assay done to check the nativity and integrity of the protein was the erythrocyte binding assay. In this assay, about 10 meg of the purified protein was bound to washed human erythrocytes for about an hour at room temperature. The erythrocytes were then washed to remove any unbound material and then the bound protein was eluted using 1.5M NaC1. This eluted fraction was run on SDS-PAGE gel.

primary and secondary antibodies (Western blotting); finally after development of the membrane using the appropriate substrate the transferred protein bands could be seen. Presence of protein band at the level of the target protein in eluted samples indicated proper functionality, Control erythrocytes treated with chymotrypsin to remove the Duffy antigen from their surface and so should not bind any PvRII (Duffy Binding Protein) present in sample and so should not show any band in Western blotting. The purified protein consistently passed all the characterization tests to confirm is purity, strength and activity.

Stability studies:

Three batches of this protein were subjected to stability studies in glass containers at the final concentration (between 0.5 and 1.5 mg/mL) obtained at 2-8 deg.C for 24 months and at 25±1 deg.C (accelerated study) for 6 months. The parameters analyzed to check stability were Physical description, pH, Protein content & Purity by Reverse Phase HPLC (RP-HPLC), Protein Profile by SDS-PAGE, EBA, Sterility and Bacterial Endotoxin Content by LAL assay. In both conditions of storage the protein was found to be stable, maintaining its sterility, purity, integrity and functionality. Some profiles of the assay values of the rPvRII bulk antigen are given in Figure 9.

EXAMPLE 5:

Formulations of the protein:
Two formulations of purified protein [one with alum (aluminium hydroxide), the gold-standard adjuvant, and the other a lyophilized one with sugar] .were made. For the lyophilized formulation, the composition and cycle were optimized for the protein. The required concentration of protein was lyophilized with sucrose as the stabilizer. The freezing was done to below -50 deg.C for up to 6-8 hours; primary drying was done in stages between the temperatures of-55 deg.C up to +23 deg.C for a time of 31-37 hours; the secondary drying was done at a temperature between +23 deg.C and +25 deg.C for a time of up to 6-8 hours. The composition was stable as shown by the study done up to 3 years of storage at 2-8 deg.C (refer Figure 11). This was done to prevent stability issues that have arisen due to pre-mixing of antigens with the new-age oil-based adjuvants mentioned in literature, and to harness the immune-enhancing power of the latter in eliciting memory responses and antibody titres.

Both the formulations were checked for storage stability at 2-8 deg.C for 36 months and
at 25±1 deg.C (accelerated study) for 6 months. The parameters analyzed to check
stability of alum formulation were Physical description, pH,- Protein content by BCA,
Protein Profile by SDS-PAGE, Western Blotting, Sterility and Pyrogen Testing. The
parameters analyzed to check stability of lyophilized composition were Physical
description, pH, Protein content & Purity by Reverse Phase HPLC (RP-HPLC), Protein
Profile by SDS-PAGE, EBA, Moisture content. Sterility and Bacterial Endotoxin
Content by LAL assay. In both conditions of storage, both formulations of the protein
were found to be stable, maintaining the sterility, purity, integrity and functionality.
Some profiles of the assay values of the formulated material are given in Figures 10 &
11. ^

Both the above compositions were then tested in various combinations with other adjuvants for evaluating immunogenicity.

The alum formulation was kept as the base. A second formulation was alum with the non-CpG molecule (IMT-504). For the other formulations, the lyophilized composition was used with various adjuvants as follows: Montanide ISA-720 (a highly refined emulsifier from the mannide monooleate family in a natural metabolizable oil solution from Seppic, France), MF-59 (a type of squalene-oil-water emulsion), MPL (mono-phosphoryl lipid A) and QS-21 (a water-soluble triterpene glucoside compound of saponin family extracted from Quillaja saponaria).

The alum-based formulations had the protein at the required dosage level in phosphate buffered saline, pH 7.2±0.2 with alum at a concentration not more than 1.25mg/dose as A10H3, all components mixed together by stirring. The alum-IMT 504 formulation had the latter added to the alum formulation at 50 to 100 microgram concentration per dose.
For other formulations, the lyophilized composition was mixed with the respective oil-based adjuvant so as to form a stable emulsion; this was obtained using a double-syringe system with inter-connection between the syringes. The protein and the adjuvant were mixed in required ratios and passed under pressure between the syringes to form an emulsion and this formulation was used within a maximum of 12 hours.

For these studies, formulations of the bulk / lyophilized rPvRII as appropriate for the adjuvant used were made to give two different final dosage concentrations of 10 μg and
22 25 fig. Inbred Ba1b/C mice were used for the study, chosen based on earlier experimental data. For each formulation one group of 5 mice were used, with one control group which was administered with PBS diluent. Two doses of the dosage concentrations in 0.5mL volumes, on days'C and '28/ were give intramuscularly. Animals were bled on days -1, 21, 56 and 84. Sera were collected from each sample; sera from each group and each bleed were separately pooled and stored at -20 deg.C until analysis.

ELISA method was used to estimate the antibody litres in the serum samples, using plates coated with 2(ig of purified rPvRII antigen. After blocking the coated-plates, several dilutions of the sera starting from 'neat sample (0)' through 1000, 2000, 4000, 8000 and 12000 were added to the assigned wells and incubated for 90-120 minutes at 37 deg.C under mild shaking. After washing the wells post-incubation using PBS/Tween-20, Goat anti-mouse HRPO-conjugated secondary antibody was added to the wells and again incubated for 60-90 minutes at 37°C under mild shaking. After washing the wells post-incubation using PBS/Tween-20, the substrate solution containing Diamino-benzidine (DAB) was added to each well and incubated under mild shaking at 25-30 deg.C for 5 minutes. 2N sulphuric acid was then added to each well to stop colour development and the plates were read at 490nm using an ELISA reader. The end-point litres were then calculated using the readings obtained. The results were then plotted using MS-Excel programme to check and compare the immunogenic responses.

Though most of the oil-based adjuvants, including the Montanide ISA-720 mentioned above, have been tried with the many vaccine-candidate molecules, the novelty is in the formulation strategy of using a lyophilized preparation with the adjuvants to enable mixing the adjuvants with the antigen and administering within a short time. This precludes any possible stability issues and also helps in eliciting good immunogenic responses in animal studies as shown by the data given in Figure - 12.

All the formulations were shown to elicit high antibody litres, with the order of response from high to low being as follows: Montanide ISA720 > MF59 > MPL > QS2I > Alum > Alum+CPG. These responses were consistent with earlier available results of rPvRII produced involving different refolding process.

The stability study results of the bulk antigen / formulations and the efficacy results of the formulations reveal that the process developed for the expression and purification of the protein had worked very well and had given a stable and quahty protein; and the

formulation strategy used had clearly overcome the stability issues related to the adjuvants used and resulted in very good immune responses to the antigen.

EXAMPLE 6:

Isolation and purification of recombinaDt PfF2 expressed as inclusion body in £. coli:
PfF2 is a part (F2) of 'Region-ir of EBA-175 (Erythrocyte Binding Antigen-175 kDa), a P. falciparum surface protein. RII is a 616 amino acid fragment of EBA-175 that consists of two cysteine-rich regions — Fl and F2. Fl and F2 are homologous to the Duffy binding protein of P. vivax and are therefore called Duffy binding-like (DBL) domains. This PfF2 is -42 kDa protein.

Again a synthetic gene of this rPfF2 is cloned similar to the way it was done for rPvRII, expressed as inclusion bodies in E. coli with required changes made as discerned by those experienced in the art. The IB's are solubilized, and purified through IMAC. Refolding of the purified fraction at 10 deg.C was tried using the three methods mentioned in Table-2 above. The final purification is through Ion-exchange step. The final protein is in citrate phosphate buffer (50mM, pH -5.8) with maximum of 10mM NaC1.

The only difference in the process of purification of PfF2 is the buffer used and its pH, during refolding and ion-exchange chromatography steps. Due to proteins's lower pi (around 6,5), the buffer used here was citrate-phosphate, pH 5.8 instead of the Tris buffer used for rPvRII purification. The process resulted in similar yields and purity of the rPfF2 protein as obtained for rPvRII. The protein was characterized as done for bulk antigen of rPvRII with similar parameters analyzed, including EBA where the chemical used for removing the antigen epitope from RBC’s is Neuraminidase instead of Chymotrypsin. The lot release results of the three batches proved the consistency of the process.

The refolding method given in Example 2 above gave the highest refolding yield with rPfF2 also, proving that the method works very well for proteins like these having multiple cysteines and so many disulphide bonds..

The resulting protein is also checked for its stability since the inherent structure of rPfF2, when compared to rPvRII, is not very stable the storage conditions chosen for the testing were -70 deg.C for long-term storage (24 months) and 2-8 deg.C for accelerated study (6 months). These stability study results of the bulk antigen reveal that the process developed for the expression and purification of the protein has worked very well and has given a stable (albeit at a lower temperature than rPvRII) and quality protein.

WE CLAIM:

1. A stable immunogenic protein having multiple cysteines molecules preferably
wherein the protein is having stability up to two years and purity more than 98%
when prepared by the process comprising;
a) culturing the host E. coli cells containing a desired recombinant gene construct comprising a codon optimized gene sequence of a protein to produce cells in high density,
b) inducing expression of the target protein as inclusion bodies,
c) harvesting the cells and isolating the said inclusion bodies,
d) separating the protein from inclusion bodies by repeated sequential washing and solubilizing with chaotrophic agents comprising guanidine hydrochloride and/or urea,
e) purifying die protein by subjecting to metal-chelate affinity chromatography,
f) re-folding of the purified protein obtained in step e) with a redox system to recover a high yield of the soluble protein, followed by
g) further purifying the desired protein by removing impurities by subjecting to chromatography.

2. A protein as claimed in claim 1 is stable for twenty four months at a temperature between 1-8ºC and six months at a room temperature.

3. A protein as claimed in claim 1 is rPvRII and/or rPfF2.

4. A method as claimed in claim 1, wherein the repeated sequential washing is effected by washing with buffer.

5. A method as claimed in claim 1, wherein the buffer used is a low salt buffer consisting of 5-50mM Tris, 2-25mM EDTA, 50-100mM sodium chloride, 1-6M urea, 0.1-1% Triton X-100, pH 6.5-7.5 followed by high salt buffer containing 5-50mM Tris, pH 6.5-7.5 and 0.5-lM sodium chloride.

6. A method as claimed in claim 1 wherein the harvesting, separating, isolating and solubilizing is carried out under denaturing conditions.

7. A method as claimed in claim 1, wherein the refolding is effected employing a buffer containing a detergent - dextrin mixture, a co-solvent and a redox pair.

8. A method as claimed in 7, wherein the detergent used is a non-ionic one, preferably Triton X-100 at a concentration of 0.1-1.0mM, a dextrin, preferably beta-cyclodextrin, L-Arginine as a co-solvent and a redox pair comprising at least one of the following: oxidized and reduced glutathione; L-cysteine - cystamine dihydrochloride, preferably L-cysteine - cystamine dihydrochloride.

9. A method as claimed in 7, wherein the refolding buffer further comprising one or more of the amino acids selected from L-cystine, L-cysteine, L-proline and L-lysine.

10. A method as claimed in claim 1, wherein the re-folded PvRII is further purified by column chromatography to be free from chaotrophic agent, detergents, monomers and multimers.

11. A stable composition comprising of a protein as claimed in claim 1 wherein the protein is present in the range of 10|ig to 100ixg and pharmaceutically acceptable adjuvants.

12. A pharmaceutical composition of a protein as claimed in claim I where in rPvRII or rPfF2, preferably being lyophilized using at least one of the following: sucrose, lactose, maltose, trehalose, melibiose, mannitol, sorbitol and dextrose, or combinations thereof and in the range of 5 to 10% preferably sucrose or lactose and pharmaceutically acceptable adjuvants.

13. A pharmaceutical composition as claimed in claim 12, wherein the pharmaceutically acceptable adjuvants used are selected from, but not limited to: aluminum hydroxide, aluminum phosphate, CpG nucleotides, non-CpG nucleotides, Montanide ISA-720, MF-59, Mono-phosphoryl Lipid-A (MPL-A) and QS-21, used either singly or in combinations thereof for use as a vaccine against malarial infections.

14. A stable highly pure immunogenic protein having multiple cysteines molecules preferably- rPvRII or rPfF2, a process therefor, highly stable pharmaceutical composition thereof for use as a vaccine against malarial infections substantially such as here in described with reference to examples and drawings.

Documents

Application Documents

# Name Date
1 1356-che-2009 correspondence others 03-05-2011.pdf 2011-05-03
2 1356-che-2009 form-9 03-05-2011.pdf 2011-05-03
3 1356-che-2009 form-18 03-05-2011.pdf 2011-05-03
4 1356-che-2009 form-5.pdf 2011-09-03
5 1356-che-2009 form-3.pdf 2011-09-03
6 1356-che-2009 form-2.pdf 2011-09-03
7 1356-che-2009 form-1.pdf 2011-09-03
8 1356-che-2009 drawings.pdf 2011-09-03
9 1356-che-2009 correspondence others.pdf 2011-09-03
10 1356-che-2009 claims.pdf 2011-09-03
11 1356-che-2009 abstract.pdf 2011-09-03
12 1356-CHE-2009 DESCRIPTION(COMPLETE).pdf 2011-09-03
13 1356-CHE-2009 POWER OF ATTORNEY 16-04-2012.pdf 2012-04-16
14 1356-CHE-2009 FORM-13 16-04-2012.pdf 2012-04-16
15 1356-CHE-2009 CORRESPONDENCE OTHERS 16-04-2012.pdf 2012-04-16
16 1356-CHE-2009 CORRESPONDENCE OTHERS 25-05-2012.pdf 2012-05-25
17 1356-CHE-2009 FORM-3 25-05-2012.pdf 2012-05-25
18 1356-CHE-2009 FORM-3 07-10-2014.pdf 2014-10-07
19 1356-CHE-2009 CORRESPONDENCE OTHERS 07-10-2014.pdf 2014-10-07
20 1356-CHE-2009 FORM-13 20-04-2015.pdf 2015-04-20
21 1356-CHE-2009 EXAMINATION REPORT REPLY RECEIVED 20-04-2015.pdf 2015-04-20
22 Response to FER- 1356-CHE-2009.pdf 2015-04-21
23 FORM-3 - 1356-CHE-2009.pdf 2015-04-21
24 FORM-13 for change in address for service.pdf 2015-04-21
25 FORM-1- SIGNED.pdf 2015-04-21
26 FORM 1.pdf 2015-04-21
27 Amended Claims.pdf 2015-04-21
28 1356-CHE-2009-FORM7A(PREGRANT)-260815.pdf 2015-08-28
29 PREGRANT OPPOSITION [01-09-2015(online)].pdf 2015-09-01
30 OTHERS [01-09-2015(online)].pdf 2015-09-01
31 1356-CHE-2009-FORM7A(PREGRANT)-030915.pdf 2015-09-08
32 1356-CHE-2009-FORM7A(PREGRANT)-210915.pdf 2015-09-23
33 1356-CHE-2009-Pre Grant Opposition Letter-121015.pdf 2015-10-14
34 1356-CHE-2009-Pre Grant Reply Recieved-081215.pdf 2016-01-11
35 1356-CHE-2009-Correspondence-081215.pdf 2016-01-11
36 1356-CHE-2009-Correspondence-081215..pdf 2016-01-11
37 1356-CHE-2009-Pre Grant Reply Recieved-080116.pdf 2016-01-29
38 1356-CHE-2009-Correspondence-270416.pdf 2016-04-29
39 Other Patent Document [13-06-2016(online)].pdf 2016-06-13
40 Other Patent Document [20-06-2016(online)].pdf 2016-06-20
41 1356-CHE-2009_EXAMREPORT.pdf 2016-07-02
42 HEARING ADJOURNMENT [15-07-2016(online)].pdf 2016-07-15
43 Other Patent Document [22-07-2016(online)].pdf 2016-07-22
44 HEARING ADJOURNMENT [22-07-2016(online)].pdf_25.pdf 2016-07-22
45 HEARING ADJOURNMENT [22-07-2016(online)].pdf 2016-07-22
46 1356-CHE-2009-Power of Attorney-010816.pdf 2016-08-03
47 1356-CHE-2009-Correspondence-Power of Attorney-010816.pdf 2016-08-03
48 HEARING ADJOURNMENT [01-09-2016(online)].pdf_63.pdf 2016-09-01
49 HEARING ADJOURNMENT [01-09-2016(online)].pdf 2016-09-01
50 Other Patent Document [06-09-2016(online)].pdf 2016-09-06
51 HEARING ADJOURNMENT [23-09-2016(online)].pdf 2016-09-23
52 HEARING ADJOURNMENT [26-09-2016(online)].pdf 2016-09-26
53 PREGRANT OPPOSITION [06-10-2016(online)].pdf 2016-10-06
54 PRE GRANT OPPOSITION DOCUMENT [06-10-2016(online)].pdf 2016-10-06
55 Form 26 [04-11-2016(online)].pdf_41.pdf 2016-11-04
56 Form 26 [04-11-2016(online)].pdf 2016-11-04
57 Correspondence By Agent_PA_07-11-2016.pdf 2016-11-07
58 1356-CHE-2009-Correspondence Pa-071116.pdf 2016-11-09
59 Form 3 [19-11-2016(online)].pdf 2016-11-19
60 Other Patent Document [21-11-2016(online)].pdf_82.pdf 2016-11-21
61 Other Patent Document [21-11-2016(online)].pdf 2016-11-21
62 Marked Copy [21-11-2016(online)].pdf 2016-11-21
63 Form 13 [21-11-2016(online)].pdf 2016-11-21
64 Description(Complete) [21-11-2016(online)].pdf 2016-11-21
65 Other Patent Document [22-11-2016(online)].pdf_55.pdf 2016-11-22
66 Other Patent Document [22-11-2016(online)].pdf_54.pdf 2016-11-22
67 Other Patent Document [22-11-2016(online)].pdf_53.pdf 2016-11-22
68 Other Patent Document [22-11-2016(online)].pdf 2016-11-22
69 Other Patent Document [23-11-2016(online)].pdf_47.pdf 2016-11-23
70 Other Patent Document [23-11-2016(online)].pdf 2016-11-23
71 1356-CHE-2009-Correspondence-PA-28-11-2016.pdf 2016-11-28
72 1356-CHE-2009-Statement and Evidence (MANDATORY) [17-10-2017(online)].pdf 2017-10-17
73 1356-CHE-2009-Annexure (Optional) [17-10-2017(online)].pdf 2017-10-17
74 1356-CHE-2009-REQUEST FOR ADJOURNMENT OF HEARING UNDER RULE 129A [15-11-2017(online)].pdf 2017-11-15
75 1356-CHE-2009-REQUEST FOR ADJOURNMENT OF HEARING UNDER RULE 129A [14-12-2017(online)].pdf 2017-12-14
76 1356-CHE-2009-RELEVANT DOCUMENTS [18-01-2018(online)].pdf 2018-01-18
77 1356-CHE-2009-REQUEST FOR ADJOURNMENT OF HEARING UNDER RULE 129A [22-01-2018(online)].pdf 2018-01-22
78 1356-CHE-2009-FORM-26 [29-01-2018(online)].pdf 2018-01-29
79 1356-CHE-2009-FORM-26 [05-02-2018(online)].pdf 2018-02-05
80 Correspondence by Agent_Power of Authority_19-02-2018.pdf 2018-02-19
81 1356-CHE-2009-Request for hearing [20-02-2018(online)].pdf 2018-02-20
82 1356-CHE-2009-Representation,including the statement and evidence [20-02-2018(online)].pdf 2018-02-20
83 1356-CHE-2009-RELEVANT DOCUMENTS [23-02-2018(online)].pdf 2018-02-23
84 Notarized Agreement_Pregrant Opposition_27-02-2018.pdf 2018-02-27
85 Correspondence by Agent_Pregrant Opposition_27-02-2018.pdf 2018-02-27
86 1356-CHE-2009-Representation,including the statement and evidence [28-02-2018(online)]_24.pdf 2018-02-28
87 1356-CHE-2009-Representation,including the statement and evidence [28-02-2018(online)].pdf 2018-02-28
88 1356-CHE-2009-MARKED COPIES OF AMENDEMENTS [28-02-2018(online)]_32.pdf 2018-02-28
89 1356-CHE-2009-MARKED COPIES OF AMENDEMENTS [28-02-2018(online)].pdf 2018-02-28
90 1356-CHE-2009-FORM 13 [28-02-2018(online)].pdf 2018-02-28
91 1356-CHE-2009-AMMENDED DOCUMENTS [28-02-2018(online)]_34.pdf 2018-02-28
92 1356-CHE-2009-AMMENDED DOCUMENTS [28-02-2018(online)].pdf 2018-02-28
93 1356-CHE-2009-Amendment Of Application Before Grant - Form 13 [28-02-2018(online)].pdf 2018-02-28
94 Correspondence by Agent_Pre-grant Opposition_01-03-2018.pdf 2018-03-01
95 1356-CHE-2009-PETITION UNDER RULE 138 [15-03-2018(online)].pdf 2018-03-15
96 1356-CHE-2009-RELEVANT DOCUMENTS [16-03-2018(online)].pdf 2018-03-16
97 1356-CHE-2009-PETITION UNDER RULE 138 [16-03-2018(online)].pdf 2018-03-16
98 1356-CHE-2009-Written submissions and relevant documents (MANDATORY) [14-04-2018(online)].pdf 2018-04-14
99 1356-CHE-2009-Statement and Evidence (MANDATORY) [14-04-2018(online)].pdf 2018-04-14
100 1356-CHE-2009-RELEVANT DOCUMENTS [14-04-2018(online)].pdf 2018-04-14
101 1356-CHE-2009-MARKED COPIES OF AMENDEMENTS [14-04-2018(online)].pdf 2018-04-14
102 1356-CHE-2009-AMMENDED DOCUMENTS [14-04-2018(online)].pdf 2018-04-14
103 1356-CHE-2009-Amendment Of Application Before Grant - Form 13 [14-04-2018(online)].pdf 2018-04-14
104 1356-CHE-2009-Statement and Evidence (MANDATORY) [16-04-2018(online)].pdf 2018-04-16
105 1356-CHE-2009-Request for hearing [16-04-2018(online)].pdf 2018-04-16
106 1356-CHE-2009-Representation,including the statement and evidence [16-04-2018(online)].pdf 2018-04-16
107 1356-CHE-2009-RELEVANT DOCUMENTS [06-08-2018(online)].pdf 2018-08-06
108 1356-CHE-2009-PETITION UNDER RULE 137 [06-08-2018(online)].pdf 2018-08-06
109 1356-CHE-2009-RELEVANT DOCUMENTS [20-08-2018(online)].pdf 2018-08-20
110 1356-CHE-2009-REQUEST FOR ADJOURNMENT OF HEARING UNDER RULE 129A [07-01-2020(online)].pdf 2020-01-07
111 1356-CHE-2009-REQUEST FOR ADJOURNMENT OF HEARING UNDER RULE 129A [07-02-2020(online)].pdf 2020-02-07
112 1356-CHE-2009-PreGrant-HearingNotice-(HearingDate-03-08-2020).pdf 2020-07-01
113 1356-CHE-2009-Written submissions and relevant documents [17-08-2020(online)].pdf 2020-08-17
114 1356-CHE-2009-RELEVANT DOCUMENTS [17-08-2020(online)].pdf 2020-08-17
115 1356-CHE-2009-PETITION UNDER RULE 138 [17-08-2020(online)].pdf 2020-08-17
116 1356-CHE-2009-FORM-26 [13-09-2020(online)].pdf 2020-09-13
117 1356-CHE-2009-Written submissions and relevant documents [18-09-2020(online)].pdf 2020-09-18
118 1356-CHE-2009-Annexure [18-09-2020(online)].pdf 2020-09-18
119 1356-CHE-2009-Written submissions and relevant documents [26-09-2020(online)].pdf 2020-09-26
120 1356-CHE-2009-RELEVANT DOCUMENTS [29-09-2020(online)].pdf 2020-09-29
121 1356-CHE-2009-PETITION UNDER RULE 138 [29-09-2020(online)].pdf 2020-09-29
122 1356-CHE-2009-Written submissions and relevant documents [29-10-2020(online)].pdf 2020-10-29
123 1356-CHE-2009-Annexure [29-10-2020(online)].pdf 2020-10-29
124 1356-CHE-2009-PatentCertificate10-03-2021.pdf 2021-03-10
125 1356-CHE-2009-IntimationOfGrant10-03-2021.pdf 2021-03-10
126 1356-CHE-2009-PreGrant-ExtendedHearingNotice-(HearingDate-14-09-2020).pdf 2021-10-03
127 1356-CHE-2009-RELEVANT DOCUMENTS [28-09-2022(online)].pdf 2022-09-28
128 1356-CHE-2009-RELEVANT DOCUMENTS [29-09-2023(online)].pdf 2023-09-29

ERegister / Renewals

3rd: 09 Jun 2021

From 09/06/2011 - To 09/06/2012

4th: 09 Jun 2021

From 09/06/2012 - To 09/06/2013

5th: 09 Jun 2021

From 09/06/2013 - To 09/06/2014

6th: 09 Jun 2021

From 09/06/2014 - To 09/06/2015

7th: 09 Jun 2021

From 09/06/2015 - To 09/06/2016

8th: 09 Jun 2021

From 09/06/2016 - To 09/06/2017

9th: 09 Jun 2021

From 09/06/2017 - To 09/06/2018

10th: 09 Jun 2021

From 09/06/2018 - To 09/06/2019

11th: 09 Jun 2021

From 09/06/2019 - To 09/06/2020

12th: 09 Jun 2021

From 09/06/2020 - To 09/06/2021

13th: 09 Jun 2021

From 09/06/2021 - To 09/06/2022

14th: 08 Jun 2022

From 09/06/2022 - To 09/06/2023

15th: 08 Jun 2023

From 09/06/2023 - To 09/06/2024

16th: 08 Jun 2024

From 09/06/2024 - To 09/06/2025