Sign In to Follow Application
View All Documents & Correspondence

Variants Of Human Gdnf

Abstract: The present invention relates to novel variants of human glial cell-derived neurotrophic factor (GDNF) and methods for their use.

Get Free WhatsApp Updates!
Notices, Deadlines & Correspondence

Patent Information

Application #
Filing Date
21 August 2013
Publication Number
01/2015
Publication Type
INA
Invention Field
BIOTECHNOLOGY
Status
Email
ipo@knspartners.com
Parent Application
Patent Number
Legal Status
Grant Date
2019-01-28
Renewal Date

Applicants

ELI LILLY AND COMPANY
Lilly Corporate Center Indianapolis Indiana 46285

Inventors

1. LEUNG Donmienne Doen Mun
c/o Eli Lilly and Company P.O. Box 6288 Indianapolis Indiana 46206 6288
2. LU Jirong
c/o Eli Lilly and Company P.O. Box 6288 Indianapolis Indiana 46206 6288
3. MERCHANT Kalpana Mahesh
c/o Eli Lilly and Company P.O. Box 6288 Indianapolis Indiana 46206 6288
4. GHANEM Mahmoud
c/o Eli Lilly and Company P.O. Box 6288 Indianapolis Indiana 46206 6288
5. OBRYAN Linda Maureen
c/o Eli Lilly and Company P.O. Box 6288 Indianapolis Indiana 46206 6288
6. SMITH Rosamund Carol
c/o Eli Lilly and Company P.O. Box 6288 Indianapolis Indiana 46206 6288

Specification

VARIANTS OF HUMAN GDNF
The present invention is in the field of medicine, particularly in the field of
therapeutic proteins. Specifically, the present invention relates to novel variants of
human glial cell-derived neurotrophic factor (GDNF). The novel variants of GDNF may
be useful for the treatment of Parkinson's disease.
GDNF is a well known neurotrophic factor that is reported to provide trophic
support to dopaminergic neurons in vitro and in vivo. Further, it has been reported that
GDNF provides functional improvements and has neuroprotective actions in rodent and
primate models of Parkinson's disease. Wild type GDNF protein from E. coli has been
administered centrally to patients suffering from Parkinson's disease with mixed results.
In two small open labeled studies, the wild type GDNF was reported to produce longlasting
improvement in motor function. However, in a randomized, placebo-controlled,
Phase Ila trial of 34 patients, intra-putamenal delivery of GDNF showed no symptomatic
improvement at 6 months. An increase in biomarker signal was only evident in the
immediate tissue surrounding the infusion site. One recent report states that GDNF may
be a promising molecule to rescue dying nerves; however, delivering the molecule to the
correct area of the brain remains a daunting challenge. Nature, Vol 466:19 August 2010.
Truncated GDNF proteins are reported in W097/1 1964 (PCT/US96/14915);
however, there continues to be a need for new GDNF variants with desired
pharmacological properties, stability and bio-distribution properties. There is a need for a
variant form of GDNF that is stable in the delivery device, and facilitates desired brain
bio-distribution, while demonstrating desired potency and acceptable immunogenicity
properties. GDNF variants offering one or more of these desirable properties may be a
new pharmaceutically useful medicinal therapy, particularly for use in the treatment of
Parkinson's disease.
The present invention provides a novel truncated GDNF variant of mature human
GDNF domain lacking the first 31 amino acids at the N-terminus ("D31-N-terminus
truncated GDNF"), with certain amino acid substitutions introduced to provide stable,
suitably potent, GDNF variants offering desirable bio-distribution properties and a
pharmaceutically acceptable immunogenicity profile. The present invention provides
certain variants of human GDNF that impart one or more advantages over mature human
wild-type GDNF including variants that have improved pharmaceutical stability, as well
as improved bio-distribution, reduced heparin binding, reduced deamidation, reduced
susceptibility to succinimide formation, and reduced immunogenicity potential compared
to human wild-type GDNF. Certain new GDNF variants may be a useful new treatment
option for Parkinson's disease patients.
The present invention provides human GDNF variant comprising SEQ ID NO: 23
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILXaa 84
NLSXaa 88NXaa 9oRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRXaa 125HSAKXaa
isoCGCI (SEQ ID NO: 23), wherein:
i) Xaa84 is K or A;
ii) Xaa8 8 is R or K;
iii) Xaago is R or K;
iv) Xaa is K or E; and
v) Xaai3o is R or E.
The invention further provides a human GDNF variant wherein said variant is
selected from the group consisting of
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNL
SRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI (SEQ ID
NO:9),
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILANL
SKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI (SEQ ID
NO: 12), and
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILANL
SKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILREHSAKECGCI (SEQ ID
NO: 15).
In an aspect, the invention provides a human GDNF variant comprising an amino
acid sequence as shown in SEQ ID NO: 9 :
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNL
SRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI.
The invention further provides an intermediate, useful for preparing a D31-Nterminus
truncated variant of mature human GDNF. The intermediate comprises the
amino acid sequence of SEQ ID NO: 23
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILXaa 84
NLSXaa 88NXaa 9oRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRXaa 125HSAKXaa
i3oCGCI (SEQ ID NO: 23), which is extended at the N-terminus with a signal secretion
peptide. Numbers of signal secretion peptide sequences can be used herein. Exemplary
signal secretion peptide sequences include murine kappa leader signal secretion peptide
having a sequence of METDTLLLWVLLLWVPGSTG (SEQ ID NO: 25), and human
growth hormone signal secretion peptide having a sequence of
MATGSRTSLLLAFGLLCLPWLQEGSA (SEQ ID NO: 32).
Intermediates having these signal secretion peptides can produce the claimed
human GDNF variants with increased yield over truncated GDNF constructs having other
leader sequences. The disclosed intermediates including signal secretion peptide can thus
have an amino acid sequence of
METDTLLLWVLLLWVPGSTGRGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIF
RYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVY
HILRKHSAKRCGCI (SEQ ID NO: 28); or
MATGSRTSLLLAFGLLCLPWLQEGSARGQRGKQRGCVLTAIHLNVTDLGLGYET
KEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACCRPIAFDDDLSFLD
DNLVYHILRKHSAKRCGCI (SEQ ID NO: 35).
The invention provides a pharmaceutical composition, comprising a variant of
human GDNF as claimed by the present invention and one or more pharmaceutically
acceptable diluents, carriers or excipients. The invention provides a variant of human
GDNF for use as a medicament. The invention further provides a variant of human
GDNF for use in the treatment of Parkinson's disease. The invention provides a variant
of GDNF for use as a therapy.
A variant wherein Xaas4 isA, Xaass is K, and aa9ois K is preferred.
A variant wherein Xaas4 is K, Xaa is R, and Xaago is R is preferred.
A variant wherein Xaa is K and Xaa 13ois R is preferred.
A variant wherein Xaas4 isA, Xaass is , and Xaago is K, Xaa is E and Xaai 3ois E
is preferred.
DETAILED DESCRIPTION
It has been reported that wild type GDNF binds to heparin and extracellular
matrix, likely through the positive charges located in the N-terminal 1-31 amino acid
residues, therefore limiting the distribution of GDNF upon delivery in the brain (Lin et
al, JNeurochem 63, 758-768, 1994; Rickard et al, Glycobiology 13, 419-426, 2003;
Piltonen et al, Experimental Neurology 219, 499-506, 2009) . It has also been reported
that GDNF provides functional improvements and has neuroprotective actions in rodent
and primate models of Parkinson's disease (Tomac et al, 1995; Gash et al, 1996). Wild
type GDNF protein from E. coli has been administered centrally to patients suffering
from Parkinson's disease with mixed results. In two small open labelled studies, GDNF
produced long-lasting improvement in motor function (Gill et al, 2003, Slevin et al,
2005). In addition, increased dopaminergic neuron sprouting was evident in one patient
who died of unrelated causes - myocardial infarction (Love et al 2005). However, in a
randomized, placebo-controlled, Phase Ila trial of 34 patients conducted by Amgen, intraputamen
delivery of GDNF (Liatermin) showed no symptomatic improvement at 6
months (Lang et al, 2006). The claimed GDNF variants exhibit improved properties
compared to the previously tested wild type GDNF protein from E. coli.
Wild type GDNF full length construct sequence (21 laa) containing the signal
peptide (the first 19 amino acids, SEQ ID NO: 4), pro-domain (italics, SEQ ID NO: 5),
and mature peptide (underlined, SEQ ID NO: 3) is indicated as SEQ ID NO: 1:
MKLWOVVAVCLVLLKTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPE
DYPDQFDDVMDFIQA / R RSPDKQMAVLPRRERNRQAAAANPENSRGKGRR
GQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLS
RNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI . The wild
type GDNF full length DNA sequence is indicated as SEQ ID NO: 2 :
ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCTTTCCCACTGCCAGCCGGCAAGAGACCCCCAGAGGCCCCAGCCGAGGA
CAGAAGCCTGGGCAGGCGGAGGGCCCCATTCGCCCTGAGCAGCGACAGCAAC
ATGCCAGAGGACTACCCCGACCAGTTCGACGACGTCATGGACTTCATCCAGG
CCACCATCAAGAGGCTGAAGAGGTCACCCGACAAGCAGATGGCCGTGCTGCC
CAGGCGGGAGAGGAACAGGCAGGCCGCCGCCGCCAACCCAGAGAATTCCAG
GGGCAAGGGCAGAAGGGGTCAACGGGGCAAGAACAGGGGCTGCGTGCTGAC
CGCCATCCACCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAG
GAGCTGATCTTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCT
ACGACAAGATCCTGAAGAACCTGAGCAGGAACAGGCGGCTGGTCTCCGACAA
GGTGGGCCAGGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTC
CTGGACGACAACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGAT
GCGGCTGCATC.
The amino acid positions of the variants of the present invention are determined
from the 134 amino acid polypeptide of mature human wild type GDNF (SEQ ID NO: 3).
Mutations are designated by the original amino acid, followed by the number of the
amino acid position, followed by the replacement amino acid. The numerical designation
of each variant is based on wild type mature sequence ("mature WT GDNF") before
truncation. For example, a substitution for Lys (K) at position 84 (i.e. K84) with Ala (A)
is designated as K84A. In a similar fashion, the multiple substitutions for Lys (K) at
position 84 with Ala (A), Arg (R) at position 88 with Lys (K), Arg (R) at position 90 with
Lys (K) and Asp (D) at position 95 with Glu (E) is designated as
K84A/R88K/R90K/D95E. As used herein the abbreviation "KAKKE" refers to K84AR88K-
R90K-D95E.
As used herein, "full length GDNF" refers to the full protein sequence, including
signal peptide, prodomain, and mature domain.
As used herein, "mature GDNF" or "full length mature GDNF" refers to the full
GDNF mature domain (with signal peptide and prodomain cleaved off).
As used herein, "D 31-N-terminus truncated GDNF" refers to GDNF mature
domain lacking the first 31 amino acids at the N-terminus. As used herein, "D 31-Nterminus
truncated GDNF" and "human GDNF variant" (or "GDNFv") are used
interchangeably.
Full length GDNF constructs when transfected in HEK293 cells over 5 days
produce predominantly full length mature GDNF. When full length GDNF constructs are
transfected in CHO cells over a longer period of time and during stable cell-line
generation, truncated forms of GDNF are the predominant forms (Lin et al., Science 260,
1130-1 132, 1993). Delta31 ("D31"), a truncated variant form of mature human GDNF in
which amino acid residues number 1 through 31 have been deleted at the N-terminus, has
SEQ ID NO: 8, and can be purified from the mixture.
The N-terminus truncated D31 GDNF variant can be produced in a mammalian or
bacterial expression system by deleting both the prodomain peptide sequence and the first
31 amino acid residues of the mature GDNF peptide at the DNA level, and using a
number of secretion signal sequence peptides, such as native GDNF secretion signal
peptide (SEQ ID NO: 4 : MKLWDVVAVCLVLLHTASA); murine kappa leader
secretion signal peptide (SEQ ID NO: 25: METDTLLLWVLLLWVPGSTG); and human
growth hormone secretion signal peptide (SEQ ID NO: 32:
MATGSRTSLLLAFGLLCLPWLQEGSA). These constructs can produce single species
homogenous D31-N-terminus truncated GDNF variants.
One of ordinary skill in the art would understand that the claimed GDNF variants
do not exclude the possibility of glycosylation. The claimed GDNF variants can be
glycosylated as appropriate, depending on the expression system used. For example,
mammalian expressed GDNF variants are glycosylated at position N49 while bacterial
expressed variants are not.
When full length native sequence construct is used (SEQ ID NO: 2) during
expression, a mixture of GDNF species with various N-terminal truncations are produced
as well as mature form (non-truncated) with or without the prodomain region.
The following examples, performed essentially as described below, may be used
to assess certain characteristics of human GDNF variants of the invention.
Example 1
Protein Expression, Purification and Immunogenicity Analysis
a. Sub-cloning, Mutation, Expression, Unfolding, Re-folding, and Purification of
E. coli-expressed GDNFv
Sub-cloning. E. coli strain BL21-CodonPlus (DE3)-RIPL harboring plasmid pET-
30a(+)/rhGDNF is grown on Luria-Bertani broth medium containing kanamycin at a final
concentration of 30 mg/ml overnight at 37 °C. After harvesting the cells by centrifugation
the plasmid vector is isolated by using a QIAquick Spin Miniprep kit (Qiagen) following
the manufacturer's protocol. The isolated plasmid DNA is then used for primer extension
reaction of the A31-GDNF and D 31-N38Q-GDNF genes encoding for A31-GDNF protein (
31 residues truncated from the N-terminus of mature human GDNF) and D 31-N38Q-GDNF
protein (3 1 residues truncated from the N-terminus of mature human GDNF in which the
aspargine residue at position 38 is substituted by glutamine), respectively. This may be
accomplished using the oligonucleotide primers A31-for, A31-rev, A31-N38Q-for, and A31-
N38Q-rev (SEQ ID NOs:6, 7, 39, and 40, respectively) containing Ndel and Xhol restriction
endonuclease sites designed to anneal to the 5 and 3 ends of the gene. The Ndel and Xhol
restriction sites introduced at the 5 ends of the sense and antisense primers allow cloning of
A31-GDNF and A31-N38Q-GDNF into the corresponding sites of the vector pET-30a(+).
Primer extension reaction is performed for 3 min at 94 °C, followed by 16 three-step cycles
of 1 min at 94 °C, 0.5 min at 55 °C, and 1 min at 72 °C, with a final 10 min step at 72 °C, in
a total volume of 100 mΐ by using 80 ng template DNA, forward and reverse primers, and
PCR Supermix (Invitrogen #10572-014). The resulting amplicons are verified on agarose
gel electrophoresis and cleaned using QIAquick PCR purification kit (Qiagen) following
the manufacturer's protocol.
Both the amplified D31-GDNF or D31-N38Q-GDNF gene and pET-30a(+) vector are
digested for 2 h at 37 °C with Ndel and Xhol, followed by purification of the DNA by
agarose gel electrophoresis using the QIAquick Gel Extraction kit. The D 31-GDNF or
A31-N38Q-GDNF is then ligated into the pET-30a(+) plasmid using T4 DNA ligase and
following the manufacturer's protocol. 2-5 mΐ of the ligation reaction mixtures is used to
transform directly 50-100 mΐ of E. coli strain BL21-CodonPlus (DE3)-RIPL chemically
competent cells following the manufacturer's protocol (Agilent #230280). The resulting
transformant colonies obtained by plating on Luria-Bertani agar plates containing
kanamycin at a final concentration of 30 mg/ml are screened for the presence of correct
construct through sequencing the extracted plasmid in both directions by using the standard
T7 promotor and T7 terminator oligonucleotide primers.
Mutations. Site-directed mutagenesis is carried out using a QuikChange Multi Site-
Directed Mutagenesis kit (Stratagene, La Jolla, CA) to prepare D31-N38Q-D95E-GDNF
and D31-N38Q-K84A-R88K-R90K-D95E-GDNF. The method uses D31-N38Q-GDNF,
inserted into pET-30a(+)as a template, and D3l-N38Q-D95E-for and D 3l-N38Q-D95E-rev
oligonucleotides (Table 1, SEQ ID NOs:41and 42) as forward and reverse primers,
respectively. Subsequently, the successfully mutated D 31-N38Q-D95E gene inserted into
pET-30a(+) is used as a template, and D 3l-N38Q-K84A-R88K-R90K-D95E-for and D31-
K84A-R88K-R90K-D95E-D95E-rev oligonucleotides (Table 1, SEQ ID NOs:43 and 44) as
forward and reverse primers, respectively, to produce A31-N38Q-K84A-R88K-R90KD95E-
GDNF. The DNA sequence is confirmed and the plasmid is transformed into E. coli
strain BL21-CodonPlus (DE3)-RIPL chemically competent cells.
Protein Expression. Permanent frozen stocks of E. coli cells BL21-CodonPlus (DE3)-
RIPL harboring plasmid pET-30a(+)/GDNFv are used to inoculate 50 ml of 2xTY broth
medium containing kanamycin at final concentrations of 30 mg/ml, at 37 °C. After 9 h,
5 ml of the starter culture is used to inoculate 6 2 liters of the same liquid culture medium
at 37 °C. When the culture reaches an optical density at 600 nm between 0.8 and 1.4,
typically after 16 h, IPTG is added to a final concentration of 1mM and the temperature of
the culture is lowered between 27 and 30 °C for 5 h. Cells are harvested by centrifugation at
10,000g for 20 min at 4 °C and stored at -80 °C.
Solubilization-Re-folding. The cell paste is suspended in 2-3 volumes of a solution of
0.2 mg/ml lysozyme, 5mM MgCl2 and 50 mM Tris-Cl at pH 8 and allowed to incubate with
stirring for 30 min on ice. The resulting slurry is sonicated on ice for 10 min (5 sec pulses,
2 sec interval, 30-40% amplitude). Thereafter, GDNFv is recovered in the form of
inclusion bodies which are isolated from cell lysate by centrifugation at 20,000g for 20 min
and solubilized in 4M guanidine, 90 mM cysteine, 20 mM Tris-Cl, pH 8.5. The protein is
re-folded to the active form by 10X dilution with 0.2 M guanidine, 2M urea, 20 mM Tris-
Cl, pH 8.75. The refold mixture is held at 4° C. for 2 days.
Purification. The refolded GDNFv is purified to homogeneity through 3-steps of column
chromatography:
1. Cation Exchange Chromatography (CEX) on SP column
2. Hydrophobic Interaction Chromatography (HIC) on Phenyl column
3. Size Exclusion Chromatography (SEC) on Superdex-75 column.
The re-natured protein is firstly applied to an SP Sepharose fast flow column equilibrated
in 20 mM sodium acetate, pH 5. GDNFv is eluted with an ascending linear salt gradient
from 0.3 to 1MNaCl in 20 mM sodium acetate, pH 5. The CEX mainstream pool is
supplemented with NaCl to a final concentration of 2.5 M and then applied to a Phenyl
Sepharose HP hydrophobic interaction chromatography column in 20 mM sodium citrate,
pH 5. The HIC column is eluted with a descending linear salt gradient from 2.5 to 0 M
NaCl in 20 mM sodium citrate, pH 5. GDNFv binds tightly to HIC column. The HIC
mainstream pool is then concentrated and finally applied to a Superdex-75 column and
the protein is eluted with PBS, pH 7.4. The final pool is concentrated, filtered through a
0.22 micron membrane and stored at -80 °C.
b. Expression and Purification of GDNFv in Mammalian Cells
Genes encoding GDNF variants may be prepared using standard molecular biology
techniques or by gene synthesis in a CMV promoter driven mammalian expression
vector. The recombinant plasmids are used to transiently transfect human embryonic
kidney 293EBNA (HEK293) cells and media is harvested after 5 days. In another
method, stable Chinese hamster ovary (CHO) cell lines are generated to express GDNF
variants. Genes coding for the variant proteins are subcloned into the Glutamine
Synthetase (GS)-containing expression plasmid backbones (pEE12.4-based plasmids,
Lonza Biologies, Slough, UK) in frame with the native GDNF signal sequence with prodomain
according to the manufacturer's instructions. Full length GDNF constructs (SEQ
ID NO: 2) in pEE12.4 based vectors are transfected in CHO and produce truncated forms
of GDNF where D31 is the predominant forms and can be purified from the mixture.
When the pro-domain and the first N-terminus 31 amino acids are removed, then the D31-
N-terminus truncated GDNF variant is produced efficiently and cleanly in a mammalian
expression system without the need for purification from a mixture of full length and
truncated products as reported previously. The native GDNF secretion signal peptide may
also be replaced with numbers of secretion signal peptides, including murine kappa
leader secretion signal peptide or human growth hormone secretion signal peptide. The
D31-N-terminus truncated GDNF variant is still produced efficiently and cleanly with all
the disclosed secretion signal peptides but with variable levels of expression. GDNF
variants incorporating desired mutations are subcloned into suitable expression vectors
(such as pEMK-NF2, Lonza) in frame with the murine kappa signal sequence.
Purification. GDNFv is purified to homogeneity through 4-step bead
chromatography:
1. Cation Exchange Chromatography (CEX) on SP column
2. Hydrophobic Interaction Chromatography (HIC) on Phenyl column
3. Cation Exchange Chromatography (CEX) on multimodel Capto MMC column
4. Size Exclusion Chromatography (SEC) on Superdex-75 column.
Briefly, the harvested culture media containing GDNF variant proteins is firstly applied to
an SP Sepharose fast flow column equilibrated in 20 mM sodium acetate, pH 5. GDNFv
is eluted with a linear salt gradient from 0 to 1M NaCl in 20 mM sodium acetate, pH 5.
The CEX mainstream pool is supplemented with NaCl to a final concentration of 2.5 M
and then applied to a Phenyl Sepharose HP hydrophobic interaction chromatography
column in 20 mM sodium acetate, pH 5. The HIC column is eluted with a reversed linear
salt gradient from 2.5 to 0 MNaCl in 20 mM sodium acetate, pH 5. GDNFv binds
weakly to HIC column. A pool of the flow through and early elution fractions is then
applied to the multimodel resin of Capto MMC column at pH 5. The column is washed
with 50 mM Tris-Cl, pH 8, and then GDNFv is eluted with a linear salt gradient from 0 to
1M NaCl in 50 mM Tris-Cl, pH 8. The Capto MMC mainstream is finally applied to a
Superdex-75 column and the protein is eluted with PBS, pH 7.4. The final pool is filtered
through a 0.22 micron membrane and stored at 2-8 °C.
Table 1. Oligonucleotide Primers Used for PCR and Site-directed Mutagenesis
Primer Nucleotide sequence Purpose
5'TATAC4TA rGCGTGGACAACGTGGTAAAAACCGTGGTTGTGTGCT
A3 1-for " G-3' (SEQ ID No: 6) PCR
5'-GGTGCTCGAGTTATTAAATGCAGCCGCAACGTTTCGCGCT-3'
A3 1-rev" (SEQ ID No: 7) PCR
5'-
A3 1-N38Q-for ¾6 TATACATATGCGTGGACAACGTGGTAAACAACGTGGTTGTGTGCTG PCR
-3' (SEQ ID No: 39)
5'-GGTGCTCGAGTTATTAAATGCAGCCGCAACGTTTCGCGCT-3'
A3 1-N38Q-rev" (SEQ ID No: 40) PCR
A3 1-N38Q-D95E-for 5'-GTCTGGTGAGCGAGAAAGTGGGTCAG-3' (SEQ ID No: 41) Mutagenesis
A3 1-N38Q-D95E-rev 6 5'-CTGACCCACTTTCTCGCTCACCAGAC-3' (SEQ ID No: 42) Mutagenesis
A31-N38Q-KAKKE- 5'-
CCTATGATAAAATCCTGGCAAACCTGAGCAAGAACAAACGTCTGG Mutagenesis
for6
TGAGCGAGAAAG-3' (SEQ ID No: 43)
5'- A31-N38Q-KAKKEb
CTTTCTCGCTCACCAGACGTTTGTTCTTGCTCAGGTTTGCCAGGATT Mutagenesis
rev TTATCATAGG-3' (SEQ ID No: 44)
Endonuclease restriction sites for Ndel and Xhol enzymes are italicized. Underlined letters indicate
mismatches.
Epivax analysis of immunogenicitypotential
Selected human GDNF variants with a reduced probability of binding HLA-DR
are made (SEQ ID NOs: 12 and 15) and compared to wild type GDNF in the GFRa and
heparin binding assay.
Example 2
Stability of GDNF wildtype and D31 GDNF variant
The stability of the full length mature GDNF wildtype and the D31-N-terminus truncated
GDNF variants may be assessed using a number of analytical techniques such as RPHPLC,
SE-HPLC, Cation Exchange HPLC, and mass spectrometry to identify any
degradation sites in these molecules. Mutations are then made to remove the chemical
degradation sites to improve stability of human GDNF variant.
Analytical reverse phase chromatography (RP-HPLC). On Zorbax Cg SB-300A, 3.5
micron, 4.6 x 50 mm column heated at 60 °C (Agilent Technologies # 865973-909).
Mobile phase is 0.1% TFA in H20 . GDNFv elutes as a single peak at 2 14 nm with a
retention time of 19-20 min by a linear acetonitrile gradient from 5 to 50% over 30 min at
a flow rate of 1 ml/min for 35 min.
Analytical size exclusion chromatography (SEC-HPLC). On TSK-G-2000-SW-XL ,
5 micron, 7.8 x 300 mm column (TOSOH BIOSEP #08540). Mobile phase: PBS +
350 mM NaCl, pH 7.4, at a flow rate of 0.5 ml/min for 35 min. GDNFv elutes as a single
peak at 214 nm with a retention time of -16-17 min.
Analytical Cation Exchange Chromatography (CEX-HPLC). On Dionex, Propac
WCX-10, 4 x 250 mm column (Dionex #054993). Mobile phase is 20 mM sodium
Phospahte, 10% acetonitrile, pH 7. GDNFv elutes as a complex peak with a retention
time of 25-30 min by a linear salt gradient from 0.15 to 0.6 MNaCl over 45 min with a
flow rate of 1 ml/min for 52 min.
Chemical Stability Analysis (LC-MS) of Wild Type (full length bacterial GDNF) vs
Wild Type CHO GDNFv (N-terminus Ail truncated GDNF).
Wild type (full length bacterial GDNF) vs wild type CHO GDNFv (N-terminus
D 31 truncated GDNF) are stressed at 37 °C for 4 weeks to identify amino acids that may
be associated with chemical instability.
Samples
1- WT E.coli full length GDNF at 4 °C for 4 weeks, 1.0 mg/mL
2- WT E.coli full length GDNF at 37 °C for 4 weeks, 1.0 mg/mL
3- WT CHO D31-GDNFv at 4 °C for 4 weeks, 1.0 mg/mL
4- WT CHO D31-GDNFv at 37 °C for 4 weeks, 1.0 mg/mL
Intact and Partially Molecular Analysis. A 10 aliquot of each sample ( solution is
mixed with 20 m of water or 10 m aliquot of each solution) is mixed with 40 m of 100
mM tris-HCl buffer, pH8, 1.0 m of 50 mg/mL DTT at ambient temperature for 30 min.
Each sample is submitted for LC/MS analysis.
Lys-C Digest. A 20 mΐ aliquot of each sample solution is lyophilized to dryness under
speed vacuum system and the material is then reconstituted in 0.5 m of 50 mg/mL DTT
and 4.5 mΐ of 6 M guanidine-HCl, 0.5 M tris-HCl buffer, pH 8. The mixture is incubated
at 37 °C for 30 minutes and each solution is then diluted with 93 m of water and treated
with 2 of 0.2 mg/mL Lys-C (Wako) at 37 °C for 2 hours. For CHO GDNFv, 30 of
the tryptic digest is treated with 0.5 mΐ of PNGase F at 37 °C for 1 hour (to assess the
carbohydrate profile). The digest is acidified with 2 m of 10% TFA in ¾ 0 before
LC/MS analysis.
LC/MS Analysis. The sample solutions are analyzed by a Waters SYNAPT mass
spectrometry coupled with a Waters Acquity UPLC or a Water LCT premier mass
spectrometry coupled with a Waters 2795 HPLC.
Top-Down Analysis. The cleavage products for wild type GDNF are obtained by LC-MS
analysis for partially reduced GDNF. Multiple cleavage products are identified and
quantitative data for those cleavages are showed on Table 2. Several cleavages
(cleavages between N15/R16, N22/P23, N25/S26, and N38/R39) have similar
degradation pathways as deamidation through succinimide formation. For wild type
CHO D31-GDNFv, the first 31 amino acid residues are cleaved from the N-terminus.
Although CHO GDNFv has two potential N-glycosylation sites per chain, only one site is
N-glycosylated. Major glycans observed are di- or tri-antennary oligosaccharides with
different galactosylation. Interestedly, no significantly sialylated glycans are detected.
(Table 3)
Bottom-Up Analysis (Peptide Mapping). UV chromatograms of Lys-C digest of reduced
GDNF stability samples show that, with the exception of GDNF peptide 126-129, all the
expected peptides are detected. For CHO material, N-terminal peptides (before R32) are
not detected. Peptide 38-60 containing N49 is glycosylated and more than 95% of Asn49
is occupied. Peptide 85-96 containing N85 is not glycosylated. These results are
consistent with LC/MS analysis for reduced GDNF samples.
Overall, homo dimer for both wild type and CHO materials is the major
component. The minor component, which elutes early, is monomer. According to mass
spectroscopy analysis, GDNF Cys41 forms a disulfide bond with a free Cys residue for
the monomer. Relative percent for the monomer peaks is very low, and they are <1% for
CHO and <0.5% for the wild type by ultraviolet analysis. The monomer content is not
changed for the stressed materials.
The degradations, such as oxidation, deamidation and isomerization, are also
obtained from the peptide mapping. The results are shown in Table 4. Wild type full
length GDNF from E. coli. contains two Met residues, M(-l) and M6, and oxidation for
those sites are relatively low. GDNF does not contain any Trp residue. GDNF has eight
Asp residues for the full length monomer. The major deamidation sites are N25 and N38.
Since deamidation occurs much faster at high pH buffer, relative percentage for those
sites should be low when stressed in pH 5 or 6 buffer. One isomer peptide, 85-96, is
identified but it is not clear due to isomerization of Asp to Iso-Asp or racemization of
amino acid residue. It is well-known that high pH stress is generally racemization and
low pH stress is Asp isomerization. For wild type full length GDNF, several peptides
show the different masses for both the control (4 °C) and stressed (37 °C) samples. They
are most likely mis-incorporation during E. coli. biosynthesis.
Table 2. Relative Percent of GDNFs Cleavage.
WT- E. coli GDNF WT- E. coli GDNF CHO-A31- GDNFv
GDNF Peptides
4 weeks, 4 °C 4 weeks, 37 °C 4 weeks, 37 °C
Met + 1 - 134 90.9 57.6 NA
1-134 2.8 4.1 NA
2-134 2.5 4.2 NA
3-134 <0.5 1.5 NA
7 - 134 0.5 2.4 NA
16 - 134 <0.5 2.9 NA
Pyro E17, 17 - 134 <0.5 2.9 NA
18 - 134 0.6 2.0 NA
19 - 134 1.7 4.1 NA
20-134 <0.5 3.8 NA
26 - 134 <0.5 2.7 NA
32 - 134 <0.5 2.9 97.3
39 - 134 <0.5 4.5 2.7
Table 3. CHO-A31-GDNFv: Glycans at Glycosylation Site N49
Glycan Formula at N49 Relative Percent
NeuAc HexNAc Hex Fc 4 °C for 4weeks 37 °C for 4 weeks
0 2 3 0 0.5 0.5
0 2 3 1 4.3 4.4
0 3 3 1.9 2.2
0 3 3 1 15.1 14.8
0 4 3 1.8 1.5
0 3 4 1 2.6 3.1
0 4 3 1 9.4 10.0
0 5 3 1.3 1.5
0 4 4 1 3.4 3.5
0 5 3 1 6.6 7.0
0 4 5 1 6.3 6.5
0 5 4 1 3.4 3.7
0 6 3 1 1.3 1.4
0 5 5 1 4.0 4.5
0 5 6 3.4 3.1
0 6 4 1 1.5 1.5
0 5 6 1 22.5 20.9
0 6 7 0.7 0.6
0 6 7 1 5.1 4.6
0 7 8 1 0.5 0.8
Aglycosylation at N49 4.3 4.1
Table 4. LC-MS Peptide Mapping.
Relative Percent (%)
Residue/Peptides WT- E. coli GDNF CHO-A31-GDNFv
4 °C, 4 weeks 37 °C, 4 weeks 4 °C, 4 weeks 37 °C, 4 weeks
Oxidation
Met(-l) 1.4 2.5 nafl nafl
Met6 6.4 11.2 nafl nafl
Deamidation
N15/N25, Major N25 2.8 61.5 na na
N38 1.9 20.3 6.7 27.6
N89 <0.5 4.0 1.2 3.5
Isomerization
GDNF Peptide 85-96 <0.5 14.4 3.6 17.7
Not available.
These data indicate that the D 31-N-terminus truncated GDNF variant produced in CHO
cells has improved chemical stability due to the deletion of the first 3 1 amino acid
residues that include significant oxidation and deamidation hot spots, as compared with
the E. c / '-produced full length wild type mature human GDNF when stressed for 4
weeks at 37 °C. Further, as shown in Table 5, significant improvement in the
biophysical and biochemical properties of two mutated D 31-N-terminus truncated GDNF
variants (N38Q and D95E, respectively) was observed after mutation as compared to
either the full length wild type E. coli GDNF or the D3 1-N-terminus truncated GDNF
variant before mutation.
Table 5. Improved Biophysical and Biochemical Properties of GDNF Variants vs Wild
Type GDNF After 4 Weeks Incubation at 37 °C Relative to the 4°C samples
CHO-A31- CHO-A31- CHO-A31-
WT- E. coli
GDNFv N38Q- N38Q-K84AGDNF
(SEQ ID D95E- R88K-R90K-
(SEQ ID NO: 8) GDNFv D95ENO:
3) (SEQ ID GDNFv
NO: 9) (SEQ ID NO:
12)
4 C 37 C 4 C 37 C 4 C 37 C 4 C 37 C
A- High Molecular Weight
Aggregate %(SEC)
a- 0.5 mg/ml na na 1.2% 2.7% 0.7% 1.4% 0.9% 1.7%
b- 0.1 mg/ml na na <2% <2% <2% <2% <2% <2%
d- 15 mg/ml na na 0.68% na 0.43% na 0.47% na
e- 15 mg/ml (3freeze/thaw) na na 0.66% na 0.41% na 0.43% na
B- Chemical Degradation (RP,
%of non main peak)
a- 0.5 mg/ml na na 4.3% 5.7% 0.3% 1.5% 0% 1.9%
b- 0.1 mg/ml na na na >90% na >90% na >90%
C- Chemical Stability and
Modification (CEX, %of main
peak)
a- 0.5 mg/ml na 8% 82.3% 30% 86% 57% 90% 62%
b- 0.1 mg/ml na na na <30% na 55% na 53%
D- N-terminal Clipping
(LC-MS mature GDNFpeptide
sequence, 1 mg/ml)
a-Met-1-134 91% 58% na na na na na na
b- 1-134 2.8% 4.1% na na na na na na
c- 32-134 <0.5% 3.0 % 98.2% 92.8% 99.6% 96.0% 98.4% 94.9%
d- 33-134 na na 1.8% 3.3% 0.4% 2.1% 1.5% 3.2%
e-34-134 na na 0.0% 1.8% 0.0% 1.9% 0.1% 1.9%
f-39-134 na na 0.0% 2.1% 0.0% 0.0% 0.0% 0.0%
E- Oxidation(LC-MS)
a- Met (-l) 1.4% 2.5% na na na na na na
b- Met (6) 6.4% 11.2% na na na na na na
/ - Deamidation (LC-MS)
a- N15/25 2.8% 6 1.5% na na na na na na
b- N38/Q38 1.9% 20.3% 3.2% 25.9% 0.7% 0.7% 0.5% 0.6%
c- N89/N85 <0.5% 4% 1.3% 2.2% 1.0% 1.7% 1.2% 1.9%
G- Isomerization/Racemization
(LC-MS)
a- peptide 85-96 <0.5% 14.4% 0.9% 12.0% 0.0% 0.2% 0.1% 0.8%
H- Glycosylation (LC-MS)
a- N49 Occupancy na na 99.3% 99.3% 99.6% 99.7% 98. 1% 97.9%
b- Sialic Acid (mole/glycan) na na 0.9 0.9 0.6 0.6 1.4 1.4
c- Di-antennary na na 7.8% 7% 10.8% 10.5% 9.8% 9.2%
d- Tri-antennary na na 54.9% 54.5% 49.5% 50.9% 55.9% 55.8%
e- Tetra-antennary na na 37.2% 38.5% 38.5% 37.5% 33. 1% 33.7%
Not available (na)
Example 3
In vitro Binding Activities
The following assays demonstrate that certain variants of human GDNF reduce heparin
binding while maintaining GFRal receptor binding to provide a variety of differential
heparin and receptor binding characteristics.
• Binding Kinetics of GDNFv to GFRs on Biacore
GDNF variants (GDNFv: N-terminus-A3 1-truncated) may be expressed in E.coli
(bacterial) or mammalian cells (CHO cells or HEK293 EBNA cells) and purified as
described in Example 1. The primary sequences of the variants remains the same
regardless which expression system is used.
A Biacore® 2000 instrument is used to measure the binding kinetics of GDNFv to
human and rat GDNF family receptors (GFRal and GFRa2). Measurements are
performed at 25°C. Samples are dissolved in HBS-EP buffer (150 mM sodium chloride,
3 mM EDTA, 0.005% (w/v) surfactant P-20, pH 7.4). Protein A, Staphylococcus aureus
is immobilized on flow cells 1to 4 of a CM4 sensor chip (GE Healthcare #BR-1005-39)
at a level of -200 response units (RUs) using amine coupling chemistry to capture GFR
Fc chimera (Recombinant Human GFRa-l/GDNF Ra-1 Fc Chimera; Recombinant
Human GFRa-2/GDNF Ra-2 Fc Chimera; Recombinant Rat GFRa-l/GDNF Ra-1 Fc
Chimera; Recombinant Mouse GFRa-2/GDNF Ra-2 Fc Chimera).
Binding is evaluated using multiple cycles. Each cycle consists of the following
steps: 1) injection of about 10 m of GFR at a concentration of ~1.0 mg/mL and a flow
rate of 10 m / h h., aiming at a capture of 120-150 RUs; 2) injection of 250 m of GDNFv
at a flow rate of 50 m / h h., in a final concentration rage between 10 nM and 0.04 nM
followed by 20 min. for dissociation; and 3) regeneration using about 30 m of 10 mM
glycine hydrochloride, pH 1.5. Association and dissociation rates for each cycle are
evaluated using a "1: 1 (Langmuir) binding" model in the BlAevaluation software, version
4.1.
The results are shown in Tables 6-8 below.
Table 6. GDNFv: Binding Kinetics and Affinity to Human GFRa-1
GDNFv kon (M 1 s ) koii (s_1) (pM)
.C / -WT-GD a (SEQ ID
(6.0 ± 2.3) x 106 (3.5 ± 0.8) x lo-4 64 ± 23 NO:3)
.C / - 31-GD (SEQ ID
(4.2 ± 1.3) x 106 (1.7 ± 0.7) x 10 4 44 NO:8) ± 30
E.coli-D31-N38Q-D95E-GDNF
(3.9 ± 1.3) x 106 (1.6 ± 0.3) x
(SEQ ID NO:9) lo 4 47 ± 25
E.Coli-A3 1-N3 8Q-K84A-R88KR90K-
D95E-GDNF (SEQ ID (5.0 ± 1.8) x 106 (1.6 ± 0.2) x lo 4 35 ± 18
NO: 12)
CHO-A31-GDNF (SEQ ID
(3.8 ± 1.5) x 106 (0.9 ± 0.1 x
NO:8) lo 4 29 ± 17
CHO-A3 1-N3 8Q-D95E-GDNF
(4.5 ± 2.1) x 106 (1.1 ± 0.2) x 10 4 30 ± 14 (SEQ ID NO:9)
CHO-A3 1-N3 8Q-K84A-R88KR90K-
D95E-GDNF (SEQ ID (6.2 ± 3.2) x 106 (1.4 ± 0.4) x lo 4 29 ± 15
NO: 12)
Determined in the presence of 400 mM NaCl.
Table 7. GDNFv: Binding Kinetics and Affinity to Human GFRa-2.
GDNFv kon (M 1 S 1) k (s_1) ft (pM)
-WT-GDNF (SEQ ID
NO:3)
CHO-A31-GDNF (SEQ ID 4
NO:8)
CHO-A31-N38Q-D95E-GDNF _ i . . 1 _4
(SEQ ID NO:9) 7 - x 5 1 4 7
CHO-A31-N38Q- K84A-R88KRR9900KK--
DD95E -GDNF (SEQ ID 9.6 x l O6 4.2 x 10~4 44
NO: 12)
Table 8. Binding Kinetics and Affinity of GDNFv to Rat GFRa-1.
GDNFv ) k f K (pM)
CHO-A31-GDNF (SEQ ID
NO:8)
CHO-A31-N38Q-D95E-GDNF 4
(SEQ ID NO:9) W ,
CHO-A31-N38Q- K84A-R88KR90K-
D95E-GDNF(SEQ ID 9.9 x 106 2.1 x 10~4 2 1
NO: 12)
Binding of Human GDNF Variants to GFRal using ELISA
GDNF wild type and variants are tested in an ELISA assay, in which binding of
the GDNF proteins to the plate-bound receptor (GFRal) is measured. A "no GDNF"
condition and/or an "irrelevant protein" condition are used as negative controls.
Each well of a 96-well plate (Greiner 655081 Immunobind ELISA plates) is
coated with 70 mΐ of human GFRal (recombinant human GFRal -Fc chimera, carrierfree)
at ^g/ml in carbonate buffer, pH 9.6. If an irrelevant receptor is coated, it is an
irrelevant Fc chimera and is coated at the same concentration as GFRal. The plates are
sealed and incubated at 4°C overnight. The wells are aspirated and washed twice with
washing buffer (20 mM Tris (hydroxymethyl) aminomethane, pH 7.4, 0.15 M NaCl, 0.1%
Tween-20), using an automatic plate washer. The plates are blocked with 200 mΐ blocking
buffer per well (3% Carnation Instant milk in the above washing buffer) for at least 1
hour at room temperature. Plates are washed twice with washing buffer.
GDNF proteins are serially diluted into blocking buffer at an appropriate
concentration range, typically beginning at 5 mg/ml and serially diluting 1:10. A no
GDNF control is used, which consists of blocking buffer alone. 50 mΐ of each GDNF
solution is added to the GFRal coated wells in triplicate. The plates are incubated for 1.5
hours at room temperature. The wells are then washed 3 times with washing buffer.
A 50 mΐ aliquot of biotinylated anti-human GDNF antibody (R&D Systems,
biotinylated goat anti-human GDNF polyclonal antibody, catalog # BAF212) diluted to a
concentration of 1 mg/ml in blocking buffer, is added to each well and incubated for 45
minutes at room temperature. The wells are then washed 3 times with washing buffer.
A 50 mΐ aliquot of horseradish peroxidase-conjugated streptavidin (Jackson
ImmunoResearch, catalog # 016-030-084), diluted 1:1000 in blocking buffer, is added to
each well and incubated for 20-30 minutes at room temperature. Alternatively, a 1:2000
dilution can be used, with an incubation time of 30-90 minutes. The wells are then
washed 3 times with washing buffer. 50 mΐ of chromogenic substrate (i.e., OPD
substrate) is added to each well and allowed to develop at room temperature for 2-3
minutes. The reaction is stopped by adding 100 mΐ of IN HC1 to each well. The
absorbance of the wells is read at 490 nm on a Molecular Devices SpectraMax250 plate
reader. The average absorbance for the triplicate wells for each condition are determined,
and the resulting values are processed for E C5 calculation with Graph Pad Prism
software to provide a 95% confidence range. Those ranges are summarized in Table 9
below.
• Binding of Human GDNF Variants to Heparin using ELISA
GDNF wild type and variants are tested in an ELISA assay, in which binding of
the GDNF proteins to plate-bound heparin is measured. A "no GDNF" condition is used
as a negative control.
Each well of a 96-well Heparin Binding plate (BD Biosciences Heparin Binding
Plates, catalog # 354676) is coated with 70 mΐ of heparin ((mixed molecular weight
heparin from Sigma, Heparin Sodium Salt from Porcine Intestinal Mucosa, catalog # H-
3149) at 5 mg/ml in PBS. The plates are sealed and incubated at room temperature
overnight, protected from light. The wells are aspirated and washed three times with
washing buffer, using an automatic plate washer. The plates are blocked with 200 mΐ
blocking buffer per well for 90-120 minutes at 37°C (plates are sealed during this
incubation). Plates are washed twice with washing buffer.
GDNF proteins are serially diluted into blocking buffer at an appropriate
concentration range, typically beginning at 5 mg/ml and serially diluting 1:10. A "no
GDNF" control, consisting of blocking buffer alone, is used. A 50 mΐ aliquot of each
GDNF solution is added to the heparin coated wells in triplicate. The plates are incubated
for 1.5-2 hours at room temperature. The wells are then washed 3 times with washing
buffer.
A 50 mΐ aliquot of biotinylated anti-human GDNF antibody, diluted to a
concentration of 1 mg/ml in blocking buffer, is added to each well and incubated for 45
minutes to 1 hour at room temperature. The wells are then washed 3 times with washing
buffer.
A 50 mΐ aliquot of horseradish peroxidase-conjugated streptavidin, diluted 1:1000
in blocking buffer, is added to each well and incubated for 20-30 minutes at room
temperature. Alternatively, a 1:2000 dilution can be used, with an incubation time of 30-
90 minutes. The wells are then washed 3 times with washing buffer. A 50 mΐ aliquot of
chromogenic substrate (i.e., OPD substrate) is added to each well and allowed to develop
at room temperature for 2-3 minutes. The reaction is stopped by adding 100 mΐ of IN
HC1 to each well. The absorbance of the wells is read at 490 nm on a plate reader. The
average absorbance for the triplicate wells for each condition are determined, and the
resulting values are processed for EC5 calculation with Graph Pad Prism software to
provide a 95% confidence range. Those ranges are summarized in Table 9 below.
Table 9
*2 individual
experiments are do
no composite
These data show that the deletion of the N-terminal 31 amino acids (variant named "CHO
D31 GDNF") from the wild type GDNF (named "WT E. coli GDNF") can reduce heparin
binding significantly (approximately 10-fold) while maintaining GFRal receptor binding,
and these data further indicate that a variety of differential heparin and receptor binding
characteristics can be achieved through additional variants of human GDNF.
Example 4
In vitro Activities
• NS-1 Neurite Outgrowth Assay
GDNF activity for neuronal differentiation is assessed using rat Neuroscreen- 1
cells (PC12 subclone). The cells are maintained in F-12K basal medium, 12.5% heat
inactivated horse serum, 2.5% heat inactivated fetal bovine serum (FBS), IX
GlutaMAX™ (Invitrogen, Cat.# 35050061), and IX Anti-anti (Invitrogen, Cat.#15240) at
37 °C, 95% humidity in collagen coated flasks. To measure neurite outgrowth, the
Neuroscreen- 1 cells are seeded into Collagen I 96-well plates at 2200 cells per well in
growth medium using only the interior 60 wells. After 24 hours of cell attachment, the
medium is removed and new growth medium containing GFRal-Fc at ^g/ml plus
GDNF diluted in an 8 point dilution series is added to the plate in either triplicate wells,
or six wells per concentration. Medium plus ^g/ml GFRal-Fc is included as a negative
control, and medium plus 25 ng/ml neurite growth factor is included as a positive control
for cell response in the assay. The plates are incubated for 96 hours at 37°C, 95%
humidity and then fixed by adding 45mΐ fixative solution to each well and incubating at
room temperature for 1 hour. The plates are washed twice with IX wash buffer from
Neurite Outgrowth Hit Kit™(Cellomics, Cat.#K07-0001-l) and then washed twice with
IX buffer from the kit. The cells are immuno-stained with the neurite outgrowth reagents
from the kit according to manufacturer's instructions. The plates are loaded onto
Arrayscan Instrument and analyzed using Arrayscan software and Neuronal Profiling
algorithm from Cellomics. Data generated by the algorithm is processed for EC50
calculation with Graph Pad Prism software.
Multiple variants are tested for activity in neuronal differentiation and the
observed EC50s for each variant are listed in Table 10A.
Table 10A. GDNFv: NS- 1 Neurite Outgrowth
EC5
GDNFv Repeats
(95% confidence
WT-GDNF (SEQ ID
3 3 - 200 pM
NO:3)
CHO-A3 1-GDNF (SEQ ID
4 2 - 82 pM
NO:8)
CHO-A3 1-N38Q-D95E-GDNF
4 7 - 227 pM
(SEQ ID NO:9)
CHO-A3 1-N38Q-K84A-R88KR90K-
D95E-GDNF (SEQ ID 5 5 2 - 3 84 pM
NO: 12)
CCHHOO--AA32 1-N38Q-K84A-R88KRR9900KK--
DD95E-K125E-R130EGDNF
(SEQ ID NO: 15)
a Not determined due t o either low potency or failure t o reach maximum plateau.
All GDNF samples tested here have activity in the neurite outgrowth assay, t o varying
degrees. The dose curves for the D 3 1-N38Q-K84A-R88K-R90K-D95E-K125E-R130E
variant d o not reach a plateau at a maximum dose in the two experiments performed, so
an EC50 could not b e calculated. The ECso 95% confidence intervals for the other four
GDNF variants overlap in range, demonstrating similar levels o f activity in this assay.
• C-Ret Receptor Phosphorylation
The c-Ret receptor phosphorylation assay can b e used t o demonstrate the induction o f
cRet receptor phosphorylation at position Y 101 6 . GDNF activity for c-Ret receptor
phosphorylation is assessed in cells from the human neuroblastoma cell line SH-SY5Y
(ATCC) which have been stably transfected t o over-express human c-Ret. The cells are
maintained in Dulbecco's modified Eagle medium (DMEM), 10% FBS, 3 mg/ml
Blasticidin. For c-Ret phosphorylation, the cells are seeded at 5 x 10 5 per well into 24-
well collagen coated plates in growth medium without Blasticidin and allowed t o attach
overnight. The medium is changed t o low glucose DMEM + 0.25% BSA (bovine serum
albumin) for 2 4 hours. Starvation medium is removed, and the cells are treated with
GDNF in no glucose DMEM, 0.25% BSA, ^g/ml GFRal-Fc for 30 minutes at 37°C.
Each GDNF variant is tested at multiple concentrations. The treatment medium is
removed, and the cells are scraped from the plate surface in ice-cold lysis buffer of M-Per
Extraction reagent + Protease Inhibitor cocktail, Phosphatase Inhibitor 1, Phosphatase
Inhibitor cocktail 2, and Phosphphatase Inhibitor cocktail 3 (Sigma™). The cell
suspensions are vortexed to complete lysis, centrifuged at 14,000 x g to pellet cell debris,
and the supernatant is quantified for protein concentration using the bicinchoninic acid
(BCA) assay reagents. For each GDNF lysate, 10mg protein is separated by 4-12%
NuPAGE® Novex® Bis-Tris Gels (Invitrogen, Cat.# NP0322) and transferred PVDF
blots. Tyrosine 1016 phospho-Ret is detected with a rabbit polyclonal antibody and goatanti-
rabbit-HRP antibody; and c-Ret is detected with a mouse monoclonal antibody and a
goat-anti-mouse-HRP antibody. The blots are developed with the Supersignal West
Pico™ (Thermo Scientific, Cat.# 34081) reagents and exposed to x-ray film.
Five GDNF variants (WT E.coli GDNF, CHO D 31 GDNF, CHO D31-N38Q-D95E
GDNF, CHO D 31-N38Q-K84A-R88K-R90K-D95E GDNF, and CHO D31-N38Q-K84AR88K-
R90K-D95E-K125E-R130E GDNF) are tested in no glucose DMEM, 0.25% BSA
medium + ^g/ml GFRal-Fc for c-Ret phosphorylation activity at four concentrations of
0.8, 2.0, 4.0, 10, 20, 50 and 100 ng/ml. Medium alone, medium + ^g/ml GFRal-Fc, and
medium + lOOng/ml CHO D31 GDNF are also tested as negative controls. Each of the
five GDNF variants induce c-Ret phosphorylation with an ECso of 8-15ng/ml. These
data demonstrate that all five GDNF variants induce c-Ret phosphorylation at Y1016 in a
dose dependent manner.
As summarized in Table 10B, the engineered A31-N-terminus truncated GDNF
variants that showed significant improvement in biophysical and biochemical properties
(Tables 5, 6, 9, and 10A) maintained optimized biological properties, e.g.,comparable
GFRal receptor binding, decreased heparin binding, and comparable neurite outgrowth,
after 4 weeks of incubation at 37 °C.
Not available (na); Not determined (nd); and No change (nc)
Example 5
GDNF Variant Activity in DA Turnover Assays
Male Sprague-Dawley rats are anaesthetized using isoflurane (3% in O2) . The
head is shaved and sterilized with iodine solution before the animal is positioned on a
stereotaxic frame with temperature-controlled mat. The eyes are protected with
ophthalmic gel and anaesthesia is maintained using isoflurane (1-2% in O2) .
A midline incision is made on the animal's head, the scalp and underlying tissue reflected
and the skull dried to visualize bregma. Coordinates for the caudate nucleus are
measured from bregma and dural surface for infusion of GDNF. A 28 gauge infusion
cannula is slowly lowered to this position, and the infusion commences 1 minute later
using a pump. A 2 mΐ bolus of the test GDNF is infused into the left hemisphere over 4
minutes at 0.5 mΐ/min, and the cannula remains in place for a further 3 minutes once the
infusion ceases. Once the cannula has been removed the incision site is closed, a postoperative
analgesic administered and the animal allowed to recover in a temperaturecontrolled
cage before transfer to a home cage. Animals are checked post-operatively in
accordance with local ethical guidelines. At an appropriate interval following the
infusion, the animal is sacrificed, the brain removed and the caudate nuclei accurately
dissected, weighed and frozen pending HPLC analysis of dopamine and metabolites.
The frozen tissue is allowed to thaw quickly and is homogenized in 0.5ml of
homogenization buffer (0. 1M perchloric acid (PCA), 0.1mM Ethylenediaminetetraacetic
acid (EDTA), 2.5mg/L ascorbic acid) before centrifugation at 20,000g for 15 minutes.
The supernatant is removed and filtered through a syringeless filtration device. Analysis
of dopamine (DA), dihydroxyphenylacetic acid (DOPAC) and homovanillic acid (HVA)
is carried out using HPLC coupled to electrochemical detection. A 20m1aliquot of each
sample is injected and quantified against an external calibration curve (LC4C, BAS,
USA). Mobile phase consists of 100 mM NaH2P0 4, 100 mM H3P0 4, 2 mM OSA, lmM
EDTA, 13% Methanol (MeOH), pH2.8 using a Hypersil BDS (Base Deactivated Silica)
(Thermo Scientific, Cat.# 28105) 150 x 3.0 mm C18 3m particle column at 40°C. Data
are collected using Empower chromatography software. A 4-parameter logistic fit is
performed on all data prior to expression as ng/g wet weight tissue. The dopamine
turnover measure is expressed as (DOPAC+HVA)/DA and comparisons performed with
left hemisphere (treated) versus right hemisphere (intact).
Table 11
Values are mean ± s.e.m. n=5 per group
** p< 0.01 or *** p<0.001 vs intact side
The data demonstrate that each of the GDNF variants named in Table 11
significantly increase dopamine turnover in the treated hemisphere, as compared to the
intact hemisphere.
Example 6
In vivo Assays
• 6-Hudroxy Dopamine ( -0 DA)-i du ed Retrograde Lesion Model
Male Sprague-Dawley rats are anaesthetized using isoflurane (3% in 02). The
head is shaved and sterilised with iodine solution before the animal is positioned on a
stereotaxic frame with temperature-controlled mat. The eyes are protected with
ophthalmic gel and anaesthesia is maintained using isoflurane (1-2% in 02).
A midline incision is made on the animal's head, the scalp and underlying tissue reflected
and the skull dried to visualize bregma. Coordinates for the caudate nucleus are
measured from bregma and dural surface for infusion of lOug 6-Hydroxydopamine (6-
OHDA). A 28 gauge infusion cannula is slowly lowered to this position and the infusion
commences 1 minute later. A 2 mΐ bolus of the 6-OHDA is infused into the left
hemisphere over 4 minutes at 0.5m1/h h and the cannula remains in place for a further 3
minutes once the infusion ceases.
At 30 minutes following the 6-OHDA infusion the test GDNF is infused using the
same protocol. Coordinates for the GDNF infusion are Anterior-Posterior +1.0, LM -2.5,
DV -4.5mm from bregma and dural surface as before.
Once the cannula has been removed the incision site is closed, a post-operative analgesic
administered and the animal allowed to recover in a temperature-controlled cage before
transfer to a home cage. Animals are checked post-operatively in accordance with local
ethical guidelines. At an appropriate interval following the infusion the animal is
sacrificed, the brain removed and the caudate nuclei and substantia nigra accurately
dissected, weighed and frozen pending HPLC analysis of dopamine and metabolites.
The frozen tissue is allowed to thaw quickly and is homogenized in 0.5ml of
homogenization buffer (0.1M PCA, O.lmM EDTA, 2.5 mg/L ascorbic acid) before
centrifugation at 20,000 xg for 15 minutes. The supernatant is removed and filtered
through a syringeless filtration device. Analysis of dopamine (DA), DOPAC and HVA is
carried out using HPLC coupled to electrochemical detection. A 20 mΐ aliquot of each
sample is injected and quantified against an external calibration curve. Mobile phase
consists of 100 mM NaH2P0 4, 100 mM H3P0 4, 2mM OSA, 1 mM EDTA, 13% MeOH,
pH 2.8 using a BDS Hypersil 150 x 3.0 mm C18 3m particle column at 40 °C. Data is
collected using Empower chromatography software. A 4-parameter logistic fit is
performed on all data prior to expression as ng/g wet weight tissue. Comparisons are
performed with left hemisphere (treated) versus right hemisphere (intact).
Table 12: Caudate nucleus
Values are mean ± s.e.m. n=8 per group
*** p<0.001 vs intact side
Table 13: Substantia Nigra
Values are mean ± s.e.m. n=8 per group
*p<0.05, ** p< 0.01 or *** p<0.001 vs intact side
# p<0.05, ## p<0.01 vs vehicle (treated side)
Administration of 6-OHDA into the caudate nucleus results in a significant decrease
in dopamine levels in the treated side compared to the intact side (Table 12). A
significant deficit is also observed in the substantia nigra (Table 13), which is prevented
by administration of GDNF. All variants of GDNF tested here are significantly different
from vehicle, comparing treated sides.
• Acute Biodistribution in Rat Brain
Male Sprague-Dawley rats are anaesthetized using isoflurane (3% in 0 2) . The head is
shaved and sterilised with iodine solution before the animal is positioned on a stereotaxic
frame with temperature-controlled mat. The eyes are protected with ophthalmic gel and
anaesthesia is maintained using isoflurane (1-2% in (¾).
A midline incision is made on the animal's head, the scalp and underlying tissue are
reflected and the skull is dried to visualize bregma. Coordinates for the caudate nucleus
are measured from bregma and dural surface for infusion of GDNF (Anterior-Posterior +
0.5, Lateral Medial -3.0, DorsalVentral -5.5 mm). A 30 gauge infusion cannula is slowly
lowered to this position, and the infusion commences 1 minute later (using a pump). A 2
mΐ bolus of the test GDNF is infused into the left hemisphere over 4 minutes at 0.5 mΐ/min,
and the cannula remains in place for a further 3 minutes once the infusion ceases. Once
the cannula has been removed the incision site is closed, a post-operative analgesic is
administered, then the animal is allowed to recover in a temperature-controlled cage. At
an appropriate interval following the infusion, the animal is sacrificed and the brain
removed and frozen pending cryosectioning for immunohistochemistry.
• GDNFImmunohistochemistry (IHC) in Rat Brain
Biodistribution of infused GDNF is tested in an immunohistochemistry assay, in
which binding of the antibody to the infused antigen (GDNF and GDNF variants) is
measured in rat brains. An isotype control antibody is used as a negative control.
Cryosectioning the frozen rat brains begins with trimming the cerebellum while
inside a cryostat at -20 degrees C, using a rat brain matrix to make a flat surface. Optimal
Cutting Temperature™ (OCT, Sakura or other similar vendors) is placed on a cooled
cryostat specimen chuck. As the OCT begins to freeze, the flat caudal surface of the rat
brain is placed on the specimen chuck using -20 degrees C cooled forceps, so that the
OCT tacks the brain in place with the rostral-most brain facing away from the specimen
chuck. The specimen chuck is placed in the object holder and tighted. After a microtome
blade has been inserted into the knife holder, the trimming function on the cryostat is used
to discard the olfactory bulbs as well as the cerebrum, rostral to the infusion track. 8um
thick sections are taken at 300 mhi intervals and placed on positively charged glass slides.
Two or three adjacent interval sections are placed on each glass slide for each rat brain.
Slides are then placed into 4% paraformaldehyde at room temperature for 20 minutes and
rinsed in tris-buffered saline tween-20 (TBST) washing buffer. Using a staining solution
at room temperature, the slides are incubated for 10 minutes with Dual endogenous
enzyme block, rinsed with TBST washing buffer, incubated for 15 minutes each of
Avidin and Biotin block, washed with TBST washing buffer, blocked with Protein block
for 60 minutes and blown off the slide using an air knife. Biotinylated anti-human GDNF
or a biotinylated goat IgG is diluted in Antibody Diluent with background reducing
agents to 2 mg/ml and incubated on the slide for 60 minutes, then rinsed with TBST
washing buffer 3 times. The slides are incubated with labelled streptavidin biotin 2
(LSAB2) (Dako, Cat.# K0609) for 10 minutes and rinsed with TBST washing buffer. The
slides are incubated with DAB+ (2 drops of DAB in DAB diluent for 5 minutes, then
rinsed with TBST washing buffer, followed by a rinse with distilled water. After slides
are removed from the autostainer, they are counterstained with Hematoxylin™ and
coverslipped using Cytoseal XYL™ (Stephens Scientific, Cat. # 8312-4). Slides are
allowed to dry and then analyzed using Aperio XT to quantify biodistribution.
• Quantification of Biodistribution of GDNF in Rat Brain
Images of the slides are acquired at the 20X magnification setting on an Aperio
ScanScope XT (running vlO.00.00.1805 of the Controller software). Meta data about the
slides is stored in Aperio's web-based software, Spectrum (vlO.0. 1346.1806).
Each brain section is manually outlined using Aperio's image viewer software,
ImageScope (vlO.0.36. 1805). For the first study, the whole brain section with the least
amount of visible sectioning artifact is outlined. For the second study, the whole brain
section closest to the slide label is outlined. Each outlined region is analyzed using
Aperio's "Positive Pixel Count" algorithm (v9) [with all the parameters kept at their
default settings, except Image Zoom = .01 and Intensity Threshold WEAK (Upper Limit)
The GDNF distribution area in mm2 for each rat is computed by summing the
positive and strong positive areas output from the positive pixel algorithm. A paired
Student's t-test is used to determine statistical significance.
Table 14. GDNFv: Rat Brain Biodistribution
Average Area of Distribution
GDNFv
(mm2)
7.05 ± 2.92 Experiment 1
C / -WT-GD (SEQ
9.16 ± 4.19 Experiment 2 ID NO: 3)
16.07 ± 5.69* Experiment 1
CHO-A31-GDNF (SEQ
20.88 ± ID NO: 8) 6.56** Experiment 2
CHO-A31-N38Q-D95E-
GDNF (SEQ ID NO: 9) 17.91 ± 1.47** Experiment 2
CHO-A31-N38Q-K84AR88K-
R90K-D95E- 20.86 ± 3.54** Experiment 2
GDNF (SEQ ID NO: 12)
Vehicle (PBS, negative
0.41 ± 0.25 Experiment 1
control)
IgG (negative control) 0.01 ± 0.03 Experiment 1
*For A 31, p<0.003 with respect to vehicle, IgG and E.coli-WT-GDNF,
^Statistically significant with respect to E.coliWT-GDNF, p<0.05
The ELISA data on heparin binding (Table 9) demonstrate that modifications to
the wild type GDNF can reduce heparin binding compared to E.coli-WT GDNF. These
data, together with the biodistribution data shown above in Table 14, confirm that
variants that decrease heparin binding can result in an increase in biodistribution in the rat
brain. N38Q-D95E and N38Q-K84A-R88K-R90K-D95E variants listed in the above table
have increased biodistribution compared to E.coli-Wl '-GDNF.
The novel GDNF variants of the present invention are preferably formulated as
pharmaceutical compositions administered by a variety of routes. Most preferably, such
GDNF variants are for parenteral or intracranial administration. Such pharmaceutical
compositions and processes for preparing same are well known in the art. See e.g.,
Remington: The Science and Practice of Pharmacy (A. Gennaro, et. al., eds., 19th ed.,
Mack Publishing Co., 1995).
A therapeutically effective amount is an amount of the novel GDNF variant of the
present invention necessary to impart a therapeutic benefit to the patient. It will be
understood that the amount of GDNF variant actually administered will be determined by
a physician, in light of the relevant circumstances, including the condition to be treated,
the chosen route of administration, the actual active agent administered, the age, weight,
and response of the individual patient, and the severity of the patient's symptoms.
SEQUENCE LISTING

MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMP
EDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGK.GR
RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNL
SRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCTTTCCCACTGCCAGCCGGCAAGAGACCCCCAGAGGCCCCAGCCGAGGA
CAGAAGCCTGGGCAGGCGGAGGGCCCCATTCGCCCTGAGCAGCGACAGCAAC
ATGCCAGAGGACTACCCCGACCAGTTCGACGACGTCATGGACTTCATCCAGG
CCACCATCAAGAGGCTGAAGAGGTCACCCGACAAGCAGATGGCCGTGCTGCC
CAGGCGGGAGAGGAACAGGCAGGCCGCCGCCGCCAACCCAGAGAATTCCAG
GGGCAAGGGCAGAAGGGGTCAACGGGGCAAGAACAGGGGCTGCGTGCTGAC
CGCCATCCACCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAG
GAGCTGATCTTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCT
ACGACAAGATCCTGAAGAACCTGAGCAGGAACAGGCGGCTGGTCTCCGACAA
GGTGGGCCAGGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTC
CTGGACGACAACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGAT
GCGGCTGCATC

SPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDL
GLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFD
DDLSFLDDNLVYHILRKHSAKRCGCI

MKLWDVVAVCLVLLHTASA

FPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMPEDYPDQFDDVMDFIQATIKRL
KR

TATACATATGCGTGGACAACGTGGTAAAAACCGTGGTTGTGTGCTG

GGTGCTCGAGTTATTAAATGCAGCCGCAACGTTTCGCGCT

RGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNL
SRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNL
SRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCTTTCCCACTGCCAGCCGGCAAGAGACCCCCAGAGGCCCCAGCCGAGGA
CAGAAGCCTGGGCAGGCGGAGGGCCCCATTCGCCCTGAGCAGCGACAGCAAC
ATGCCAGAGGACTACCCCGACCAGTTCGACGACGTCATGGACTTCATCCAGG
CCACCATCAAGAGGCTGAAGAGGTCACCCGACAAGCAGATGGCCGTGCTGCC
CAGGCGGGAGAGGAACAGGCAGGCCGCCGCCGCCAACCCAGAGAATTCCAG
GGGCAAGGGCAGAAGGGGTCAACGGGGCAAGCAGAGGGGCTGCGTGCTGAC
CGCCATCCACCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAG
GAGCTGATCTTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCT
ACGACAAGATCCTGAAGAACCTGAGCAGGAACAGGCGGCTGGTCTCCGAGA
AGGTGGGCCAGGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTT
CCTGGACGACAACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGA
TGCGGCTGCATC

MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMP
EDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGR
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNL
SRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILANL
SKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCTTTCCCACTGCCAGCCGGCAAGAGACCCCCAGAGGCCCCAGCCGAGGA
CAGAAGCCTGGGCAGGCGGAGGGCCCCATTCGCCCTGAGCAGCGACAGCAAC
ATGCCAGAGGACTACCCCGACCAGTTCGACGACGTCATGGACTTCATCCAGG
CCACCATCAAGAGGCTGAAGAGGTCACCCGACAAGCAGATGGCCGTGCTGCC
CAGGCGGGAGAGGAACAGGCAGGCCGCCGCCGCCAACCCAGAGAATTCCAG
GGGCAAGGGCAGAAGGGGTCAACGGGGCAAGCAGAGGGGCTGCGTGCTGAC
CGCCATCCACCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAG
GAGCTGATCTTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCT
ACGACAAGATCCTGGCCAACCTGAGCAAGAACAAGCGGCTGGTCTCCGAGAA
GGTGGGCCAGGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTC
CTGGACGACAACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGAT
GCGGCTGCATC

MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMP
EDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGK.GR
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILANL
SKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI

RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILANL
SKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILREHSAKECGCI

ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCTTTCCCACTGCCAGCCGGCAAGAGACCCCCAGAGGCCCCAGCCGAGGA
CAGAAGCCTGGGCAGGCGGAGGGCCCCATTCGCCCTGAGCAGCGACAGCAAC
ATGCCAGAGGACTACCCCGACCAGTTCGACGACGTCATGGACTTCATCCAGG
CCACCATCAAGAGGCTGAAGAGGTCACCCGACAAGCAGATGGCCGTGCTGCC
CAGGCGGGAGAGGAACAGGCAGGCCGCCGCCGCCAACCCAGAGAATTCCAG
GGGCAAGGGCAGAAGGGGTCAACGGGGCAAGCAGAGGGGCTGCGTGCTGAC
CGCCATCCACCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAG
GAGCTGATCTTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCT
ACGACAAGATCCTGGCCAACCTGAGCAAGAACAAGCGGCTGGTCTCCGAGAA
GGTGGGCCAGGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTC
CTGGACGACAACCTGGTGTACCACATCCTGAGGGAGCACAGCGCCAAGGAGT
GCGGCTGCATC

MKLWDVVAVCLVLLHTASAFPLPAGKRPPEAPAEDRSLGRRRAPFALSSDSNMP
EDYPDQFDDVMDFIQATIKRLKRSPDKQMAVLPRRERNRQAAAANPENSRGKGR
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILANL
SKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILREHSAKECGCI

ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCT

ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCTAGGGGTCAACGGGGCAAGCAGAGGGGCTGCGTGCTGACCGCCATCCA
CCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAGGAGCTGATC
TTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCTACGACAAGA
TCCTGAAGAACCTGAGCAGGAACAGGCGGCTGGTCTCCGAGAAGGTGGGCCA
GGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTCCTGGACGAC
AACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGATGCGGCTGCA
TC

MKLWDVVAVCLVLLHTASARGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIF
RYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVY
HILRKHSAKRCGCI

ATGAAGCTGTGGGACGTGGTGGCCGTGTGCCTGGTGCTGCTGCACACCGCCA
GCGCTAGGGGTCAACGGGGCAAGCAGAGGGGCTGCGTGCTGACCGCCATCCA
CCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAGGAGCTGATC
TTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCTACGACAAGA
TCCTGGCCAACCTGAGCAAGAACAAGCGGCTGGTCTCCGAGAAGGTGGGCCA
GGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTCCTGGACGAC
AACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGATGCGGCTGCA
TC

MKLWDVVAVCLVLLHTASARGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIF
RYCSGSCDAAETTYDKILANLSKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVY
HILRKHSAKRCGCI

RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILXaa 84
NLSXaa 88NXaa 9oRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRXaa 125HSAKXaa
i3oCGCI,
wherein:
i) Xaa 84 is K or A;
ii) Xaa 88 is R or K;
iii) Xaa9o is R or K;
iv) Xaa is K or E; and
v) Xaai3o is R or E.

MKLWDVVAVCLVLLHTASARGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIF
RYCSGSCDAAETTYDKILXaa 84NLSXaa 88NXaa 9oRLVSEKVGQACCRPIAFDDDLSF
LDDNLVYHILRXaa 125HSAKXaa13oCGCI
wherein:
i) Xaa84 isK or A;
) Xaa88 is R or K;
iii) Xaa90 is R or K;
iv) Xaa isK or E; and
v) Xaai3o is R or E.

METDTLLLWVLLLWVPGSTG

ATGGAGACAGACACACTCCTGCTATGGGTACTGCTGCTCTGGGTTCCAGGATC
TACCGGT

ATGGAGACAGACACACTCCTGCTATGGGTACTGCTGCTCTGGGTTCCAGGATC
TACCGGTAGGGGTCAACGGGGCAAGCAGAGGGGCTGCGTGCTGACCGCCATC
CACCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAGGAGCTGA
TCTTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCTACGACAA
GATCCTGAAGAACCTGAGCAGGAACAGGCGGCTGGTCTCCGAGAAGGTGGGC
CAGGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTCCTGGACG
ACAACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGATGCGGCTG
CATC

METDTLLLWVLLLWVPGSTGRGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIF
RYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVY
HILRKHSAKRCGCI

ATGGAGACAGACACACTCCTGCTATGGGTACTGCTGCTCTGGGTTCCAGGATC
TACCGGTAGGGGTCAACGGGGCAAGCAGAGGGGCTGCGTGCTGACCGCCATC
CACCTGAACGTGACCGACCTGGGCCTGGGCTACGAGACCAAGGAGGAGCTGA
TCTTCAGGTACTGCAGCGGCAGCTGCGACGCCGCCGAGACCACCTACGACAA
GATCCTGGCCAACCTGAGCAAGAACAAGCGGCTGGTCTCCGAGAAGGTGGGC
CAGGCCTGCTGCAGGCCCATCGCCTTCGACGACGACCTGAGCTTCCTGGACG
ACAACCTGGTGTACCACATCCTGAGGAAGCACAGCGCCAAGAGATGCGGCTG
CATC

METDTLLLWVLLLWVPGSTGRGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIF
RYCSGSCDAAETTYDKILANLSKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVY
HILRKHSAKRCGCI

METDTLLLWVLLLWVPGSTGRGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIF
RYCSGSCDAAETTYDKILXaa 84NLSXaa 88NXaa 9oRLVSEKVGQACCRPIAFDDDLSF
LDDNLVYHILRXaa 125HSAKXaa 13oCGCI
wherein:
i) Xaa84 is K or A;
) Xaa8 8 is R or K;
iii) Xaago is R or K;
iv) Xaa is K or E; and
v) Xaai3o is R or E.

MATGSRTSLLLAFGLLCLPWLQEGSA

ATGGCTACCGGCAGCAGGACCTCTCTGCTGCTGGCCTTCGGCCTGCTGTGCCT
GCCCTGGCTGCAGGAAGGCAGCGCC

ATGGCTACCGGCAGCAGGACCTCTCTGCTGCTGGCCTTCGGCCTGCTGTGCCT
GCCCTGGCTGCAGGAAGGCAGCGCCAGGGGTCAACGGGGCAAGCAGAGGGG
CTGCGTGCTGACCGCCATCCACCTGAACGTGACCGACCTGGGCCTGGGCTAC
GAGACCAAGGAGGAGCTGATCTTCAGGTACTGCAGCGGCAGCTGCGACGCCG
CCGAGACCACCTACGACAAGATCCTGAAGAACCTGAGCAGGAACAGGCGGCT
GGTCTCCGAGAAGGTGGGCCAGGCCTGCTGCAGGCCCATCGCCTTCGACGAC
GACCTGAGCTTCCTGGACGACAACCTGGTGTACCACATCCTGAGGAAGCACA
GCGCCAAGAGATGCGGCTGCATC

MATGSRTSLLLAFGLLCLPWLQEGSARGQRGKQRGCVLTAIHLNVTDLGLGYET
KEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACCRPIAFDDDLSFLD
DNLVYHILRKHSAKRCGCI

ATGGCTACCGGCAGCAGGACCTCTCTGCTGCTGGCCTTCGGCCTGCTGTGCCT
GCCCTGGCTGCAGGAAGGCAGCGCCAGGGGTCAACGGGGCAAGCAGAGGGG
CTGCGTGCTGACCGCCATCCACCTGAACGTGACCGACCTGGGCCTGGGCTAC
GAGACCAAGGAGGAGCTGATCTTCAGGTACTGCAGCGGCAGCTGCGACGCCG
CCGAGACCACCTACGACAAGATCCTGGCCAACCTGAGCAAGAACAAGCGGCT
GGTCTCCGAGAAGGTGGGCCAGGCCTGCTGCAGGCCCATCGCCTTCGACGAC
GACCTGAGCTTCCTGGACGACAACCTGGTGTACCACATCCTGAGGAAGCACA
GCGCCAAGAGATGCGGCTGCATC

MATGSRTSLLLAFGLLCLPWLQEGSARGQRGKQRGCVLTAIHLNVTDLGLGYET
KEELIFRYCSGSCDAAETTYDKILANLSKNKRLVSEKVGQACCRPIAFDDDLSFLD
DNLVYHILRKHSAKRCGCI

MATGSRTSLLLAFGLLCLPWLQEGSARGQRGKQRGCVLTAIHLNVTDLGLGYET
KEELIFRYCSGSCDAAETTYDKILXaa84NLSXaa NXaa 9oRLVSEKVGQACCRPIAF
DDDLSFLDDNLVYHILRXaa 2 HSAKXaai3oCGCI
wherein:
i) Xaa 4 is K or A;
) Xaa88 is R or K;
iii) Xaa90 is R or K;
iv) Xaa is K or E; and
v) Xaai3o is R or E.

TATACATATGCGTGGACAACGTGGTAAACAACGTGGTTGTGTGCTG

GGTGCTCGAGTTATTAAATGCAGCCGCAACGTTTCGCGCT

GTCTGGTGAGCGAGAAAGTGGGTCAG

CTGACCCACTTTCTCGCTCACCAGAC

CCTATGATAAAATCCTGGCAAACCTGAGCAAGAACAAACGTCTGGTGAGCGA
GAAAG

CTTTCTCGCTCACCAGACGTTTGTTCTTGCTCAGGTTTGCCAGGATTTTATCAT
AGG
SEQ ID NO: 1: AA-Human GDNF wild type full length
SEQ ID NO: 2 : DNA- Human GDNF wild type full length
SEQ ID NO: 3 : AA- Human Mature wild type GDNF
SEQ ID NO: 4 : AA- Human GDNF native secretion signal peptide
SEQ ID NO: 5 : AA- Human GDNF Pro-domain
SEQ ID NO: 6 : DNA - D31-for Primer
SEQ ID NO: 7 : DNA- D31-rev Primer
SEQ ID NO: 8 : AA-Variant 1: Delta-31 GDNF
SEQ ID NO: 9 : AA- GDNF variant 2 : A31+N38Q+D95E (clone D9) protein (103aa)
SEQ ID NO: 10: DNA construct sequence- GDNF variant 2 : A31+N38Q+D95E (clone
D9) DNA(pEE12.4)
SEQ ID NO: 11: AA- GDNF variant 2 : D31+N38Q+D95E (clone D9) protein construct
(211aa).
SEQ ID NO: 12: AA- GDNF variant 3 : D3 1 +N38Q+K84A-R88K-R90K-D95E (clone
F2.1) protein sequence (103aa)
SEQ ID NO: 13: DNA construct sequence-GDNF variant 3 : D3 1 +N38Q+K84A-R88KR90K-
D95E (clone F2.1) DNA sequence
SEQ ID NO: 14: AA- GDNF variant 3 : D31 + N38Q+K84A-R88K-R90K-D95E (clone
F2. 1) protein construct (21 laa)
SEQ ID NO: 15: AA- GDNF variant 4 : D31 + N38Q+K84A-R88K-R90K-D95E +
K125E + R130E (clone 4.3) protein sequence (103aa):
SEQ ID NO: 16: DNA construct sequence- GDNF variant 4 : D31 + N38Q+ K84AR88K-
R90K-D95E + K125E + R130E (clone 4.3) DNA sequence
SEQ ID NO: 17: AA- GDNF variant 4 : D31 + N38Q+K84A-R88K-R90K-D95E +
K125E + R130E (clone 4.3) protein construct
SEQ ID NO: 18 DNA- Human GDNF native secretion signal peptide
SEQ ID NO: 19 DNA-Native Peptide -Delta-31 N38Q+D95E Construct
SEQ ID NO: 20 AA- Native Peptide-Delta-3 1N38Q+D95E (122aa):
SEQ ID NO: 2 1 DNA- Native Peptide-Delta-3 1N38Q+K84A-R88K-R90K-D95E
SEQ ID NO: 22 AA- Native Peptide-Delta-3 1N38Q+K84A-R88K-R90K-D95E
(122aa):
SEQ ID NO: 23 AA-consensus sequence of variants
SEQ ID NO: 24 AA-Native Peptide-consensus sequence of variants
SEQ ID NO: 25 AA- Murine Kappa Leader Secretion Signal Peptide (MKL)
SEQ ID NO: 26 DNA- Murine Kappa Leader Secretion Signal Peptide (MKL)
SEQ ID NO: 27 DNA- MKL-Delta-3 1N38Q+D95E Construct
SEQ ID NO: 28 AA- MKL-Delta-3 1N38Q+D95E (123aa):
SEQ ID NO: 29 DNA-MKL-Delta-3 1N38Q+K84A-R88K-R90K-D95E Construct
SEQ ID NO: 30 AA-MKL-Delta-3 1N38Q+K84A-R88K-R90K-D95E (123aa):
SEQ ID NO: 3 1 AA-Murine Kappa Leader-consensus sequence of variants
SEQ ID NO: 32 AA- Human Growth Hormone Secretion Signal Peptide (hGH)
SEQ ID NO: 33 DNA- Human Growth Hormone Secretion Signal Peptide (hGH)
SEQ ID NO: 34 DNA- hGH-Delta-31 N38Q+D95E Construct
SEQ ID NO: 35: AA- hGH-Delta-3 1N38Q+D95E (129aa):
SEQ ID NO: 36: DNA- hGH-Delta-3 1N38Q+K84A-R88K-R90K-D95E Construct
SEQ ID NO: 37: AA- hGH-Delta-3 1N38Q+K84A-R88K-R90K-D95E (123aa):
SEQ ID NO: 38: AA-hGH-consensus sequence of variants
SEQ ID NO: 39: DNA - D3l-N38Q-for Primer
SEQ ID NO: 40: DNA - A31-N38Q-rev Primer
SEQ ID NO: 41: DNA - A31-N38Q-D95E-for Primer
SEQ ID NO: 42: DNA - A31-N38Q-D95E-rev Primer
SEQ ID NO: 43: DNA - D31-N38Q-KAKKE-for Primer
SEQ ID NO: 44: DNA - D3l-N38Q-KAKKE-rev Primer
WE CLAIM:
1. A human GDNF variant comprising the amino acid sequence of SEQ ID NO:23:
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILXaa 84NLSXaa 88NXaa 9oRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHI
LRXaa 125HSAKXaa 13oCGCI
wherein:
i) Xaa 84 is K or A;
ii) Xaas8 is R or K;
iii) Xaago is R or K;
iv) Xaa is K or E; and
v) Xaai3o is R or E.
2. The human GDNF variant as claimed by Claim 1wherein said variant is
selected from the group consisting of
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILKNLSRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAK
RCGCI (SEQ ID NO:9),
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILANLSKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAK
RCGCI (SEQ ID NO: 12), and
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILANLSKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILREHSAK
ECGCI (SEQ ID NO: 15).
3. The human GDNF variant as claimed by Claim 2 wherein said variant is
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILKNLSRNRRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAK
RCGCI (SEQ. ID: 9).
4. The human GDNF variant as claimed by Claim 2 wherein said variant is
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILANLSKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAK
RCGCI (SEQ ID NO: 12).
5. The human GDNF variant as claimed by Claim 2 wherein said variant is
RGQRGKQRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYD
KILANLSKNKRLVSEKVGQACCRPIAFDDDLSFLDDNLVYHILREHSAK
ECGCI (SEQ ID NO: 15).
6. An intermediate for preparing a D31-N-terminus truncated GDNF variant
comprising an amino acid sequence selected from the group consisting of
METDTLLLWVLLLWVPGSTGRGQRGKQRGCVLTAIHLNVTDLGLGYET
KEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACCRPIAFDD
DLSFLDDNLVYHILRKHSAKRCGCI (SEQ ID NO: 28); and
MATGSRTSLLLAFGLLCLPWLQEGSARGQRGKQRGCVLTAIHLNVTDL
GLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACC
RPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI (SEQ ID NO: 35).
7. An intermediate as claimed by Claim 6 wherein the amino acid sequence is
MATGSRTSLLLAFGLLCLPWLQEGSARGQRGKQRGCVLTAIHLNVTDL
GLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSEKVGQACC
RPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI (SEQ ID NO: 35).
8. A pharmaceutical composition comprising a human GDNF variant as claimed
by any one of Claims 1 to 5 and one or more pharmaceutically acceptable
diluents, carriers or excipients.
9. A method of treatment for Parkinson's disease comprising administering an
effective amount of the composition of Claim 8 to a human patient in need
thereof.
10. A human GDNF variant as claimed by any one of Claims 1 to 5 for use as a
medicament.
11. A human GDNF variant as claimed by any one of Claims 1 to 5 for use in the
treatment of Parkinson's disease.
12. A method for treating Parkinson's disease in a mammal, comprising the step of
administering to the mammal a human GDNF variant as claimed by any one of
Claims 1through 5.
13. A human GDNF variant as claimed by any one of Claims 1through 5 for use as
a therapy.
14. A method of treatment of Parkinson's disease comprising adminstration of an
effective amount of a human GDNF variant according to any one of claims 1to
5 to a mammal in need thereof.

Documents

Orders

Section Controller Decision Date

Application Documents

# Name Date
1 7354-DELNP-2013-GPA-(30-08-2013).pdf 2013-08-30
1 7354-DELNP-2013-RELEVANT DOCUMENTS [17-03-2020(online)].pdf 2020-03-17
2 7354-DELNP-2013-Correspondence-Others-(30-08-2013).pdf 2013-08-30
2 7354-DELNP-2013-IntimationOfGrant28-01-2019.pdf 2019-01-28
3 7354-DELNP-2013-PatentCertificate28-01-2019.pdf 2019-01-28
3 7354-delnp-2013--Form-18-(30-08-2013).pdf 2013-08-30
4 7354-DELNP-2013-Correspondence-030119.pdf 2019-01-07
4 7354-delnp-2013--Correspondence-Others-(30-08-2013).pdf 2013-08-30
5 7354-DELNP-2013-Power of Attorney-030119.pdf 2019-01-07
5 7354-delnp-2013-Correspondence Others-(09-09-2013).pdf 2013-09-09
6 7354-DELNP-2013-Written submissions and relevant documents (MANDATORY) [03-01-2019(online)].pdf 2019-01-03
6 7354-delnp-2013-Assignment-(09-09-2013).pdf 2013-09-09
7 7354-DELNP-2013.pdf 2013-09-13
7 7354-DELNP-2013-FORM-26 [02-01-2019(online)].pdf 2019-01-02
8 Specification.pdf 2013-09-17
8 7354-DELNP-2013-PETITION UNDER RULE 137 [02-01-2019(online)].pdf 2019-01-02
9 7354-DELNP-2013-HearingNoticeLetter.pdf 2018-12-27
9 Form 5.pdf 2013-09-17
10 7354-DELNP-2013-ABSTRACT [25-05-2018(online)].pdf 2018-05-25
10 Form 3.pdf 2013-09-17
11 7354-DELNP-2013-CLAIMS [25-05-2018(online)].pdf 2018-05-25
11 7354-delnp-2013-Form-3-(09-01-2014).pdf 2014-01-09
12 7354-DELNP-2013-COMPLETE SPECIFICATION [25-05-2018(online)].pdf 2018-05-25
12 7354-delnp-2013-Correspondence-Others-(09-01-2014).pdf 2014-01-09
13 7354-DELNP-2013-CORRESPONDENCE [25-05-2018(online)].pdf 2018-05-25
13 7354-delnp-2013-Form-3-(26-02-2015).pdf 2015-02-26
14 7354-delnp-2013-Correspondence Others-(26-02-2015).pdf 2015-02-26
14 7354-DELNP-2013-FER_SER_REPLY [25-05-2018(online)].pdf 2018-05-25
15 7354-delnp-2013-Form-3-(23-03-2016).pdf 2016-03-23
15 7354-DELNP-2013-OTHERS [25-05-2018(online)].pdf 2018-05-25
16 7354-DELNP-2013-Annexure [24-05-2018(online)].pdf 2018-05-24
16 7354-delnp-2013-Correspondence Others-(23-03-2016).pdf 2016-03-23
17 Form 3 [30-03-2017(online)].pdf 2017-03-30
17 7354-DELNP-2013-FER.pdf 2017-12-15
18 7354-DELNP-2013-FER.pdf 2017-12-15
18 Form 3 [30-03-2017(online)].pdf 2017-03-30
19 7354-DELNP-2013-Annexure [24-05-2018(online)].pdf 2018-05-24
19 7354-delnp-2013-Correspondence Others-(23-03-2016).pdf 2016-03-23
20 7354-delnp-2013-Form-3-(23-03-2016).pdf 2016-03-23
20 7354-DELNP-2013-OTHERS [25-05-2018(online)].pdf 2018-05-25
21 7354-delnp-2013-Correspondence Others-(26-02-2015).pdf 2015-02-26
21 7354-DELNP-2013-FER_SER_REPLY [25-05-2018(online)].pdf 2018-05-25
22 7354-DELNP-2013-CORRESPONDENCE [25-05-2018(online)].pdf 2018-05-25
22 7354-delnp-2013-Form-3-(26-02-2015).pdf 2015-02-26
23 7354-DELNP-2013-COMPLETE SPECIFICATION [25-05-2018(online)].pdf 2018-05-25
23 7354-delnp-2013-Correspondence-Others-(09-01-2014).pdf 2014-01-09
24 7354-delnp-2013-Form-3-(09-01-2014).pdf 2014-01-09
24 7354-DELNP-2013-CLAIMS [25-05-2018(online)].pdf 2018-05-25
25 7354-DELNP-2013-ABSTRACT [25-05-2018(online)].pdf 2018-05-25
25 Form 3.pdf 2013-09-17
26 7354-DELNP-2013-HearingNoticeLetter.pdf 2018-12-27
26 Form 5.pdf 2013-09-17
27 7354-DELNP-2013-PETITION UNDER RULE 137 [02-01-2019(online)].pdf 2019-01-02
27 Specification.pdf 2013-09-17
28 7354-DELNP-2013-FORM-26 [02-01-2019(online)].pdf 2019-01-02
28 7354-DELNP-2013.pdf 2013-09-13
29 7354-delnp-2013-Assignment-(09-09-2013).pdf 2013-09-09
29 7354-DELNP-2013-Written submissions and relevant documents (MANDATORY) [03-01-2019(online)].pdf 2019-01-03
30 7354-delnp-2013-Correspondence Others-(09-09-2013).pdf 2013-09-09
30 7354-DELNP-2013-Power of Attorney-030119.pdf 2019-01-07
31 7354-DELNP-2013-Correspondence-030119.pdf 2019-01-07
31 7354-delnp-2013--Correspondence-Others-(30-08-2013).pdf 2013-08-30
32 7354-DELNP-2013-PatentCertificate28-01-2019.pdf 2019-01-28
32 7354-delnp-2013--Form-18-(30-08-2013).pdf 2013-08-30
33 7354-DELNP-2013-IntimationOfGrant28-01-2019.pdf 2019-01-28
33 7354-DELNP-2013-Correspondence-Others-(30-08-2013).pdf 2013-08-30
34 7354-DELNP-2013-RELEVANT DOCUMENTS [17-03-2020(online)].pdf 2020-03-17
34 7354-DELNP-2013-GPA-(30-08-2013).pdf 2013-08-30

Search Strategy

1 7354searchstrgy_08-12-2017.pdf

ERegister / Renewals

3rd: 28 Feb 2019

From 03/04/2014 - To 03/04/2015

4th: 28 Feb 2019

From 03/04/2015 - To 03/04/2016

5th: 28 Feb 2019

From 03/04/2016 - To 03/04/2017

6th: 28 Feb 2019

From 03/04/2017 - To 03/04/2018

7th: 28 Feb 2019

From 03/04/2018 - To 03/04/2019

8th: 28 Feb 2019

From 03/04/2019 - To 03/04/2020

9th: 23 Mar 2020

From 03/04/2020 - To 03/04/2021

10th: 31 Mar 2021

From 03/04/2021 - To 03/04/2022